Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Amine oxidase [flavin-containing] A  

UniProtKB / Swiss-Prot ID :  AOFA_HUMAN

Gene Name (Synonyms) : 
MAOA  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. 

Protein Function :  Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. 

Transmembrane Topology (topPTM) : AOFA_HUMAN 

Protein Sequence MENQEKASIAGHMFDVVVIGGGISGLSAAKLLTEYGVSVLVLEARDRVGGRTYTIRNEHVDYVDVGGAYV...
Predicted Secondary Structure CCCCCCCCCCCCCCEEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEEECCCCEEEECCCCEE...
Protein Variant
LocationDescription
15D -> E (in a breast cancer sample;somatic mutation).
188E -> K (in dbSNP:rs77698881). VAR_064573
314F -> V (in dbSNP:rs1799835). VAR_014795
520K -> R (in dbSNP:rs1800466). VAR_014796
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
1N-acetylmethionine.----MENQE
----CCCCC
11.15UniProtKB
Link-
136N6-acetyllysineDNMGKEIPT
HHHHCCCCC
41.52Phosphositeplus
Link
406S-8alpha-FAD cysteine.YSGGCYTAY
CCCCCEEEE
2.88UniProtKB
Link
469Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KVTEKDIWV
CCCHHHCCC
45.18Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TPP1_HUMANcolocalizationMINT-4054731MINT17174955
A2MG_HUMANcolocalizationMINT-4054731MINT17174955
APOD_HUMANcolocalizationMINT-4054731MINT17174955
ADT2_HUMANcolocalizationMINT-4054731MINT17174955
PERM_HUMANcolocalizationMINT-4054731MINT17174955
CH60_HUMANcolocalizationMINT-4054731MINT17174955
GRP78_HUMANcolocalizationMINT-4054731MINT17174955
BGAL_HUMANcolocalizationMINT-4054731MINT17174955
CAP7_HUMANcolocalizationMINT-4054731MINT17174955
VATB2_HUMANcolocalizationMINT-4054731MINT17174955
VDAC1_HUMANcolocalizationMINT-4054731MINT17174955
VATA_HUMANcolocalizationMINT-4054731MINT17174955
ASAH1_HUMANcolocalizationMINT-4054731MINT17174955
AOFA_HUMANin vitroHPRD:02400HPRD16129825
AL3B1_HUMANENSP00000340684STRING
INMT_HUMANENSP00000340684STRING
COMT_HUMANENSP00000340684STRING
COMT_HUMANENSP00000340684STRING
COMT_HUMANENSP00000340684STRING
SNAT_HUMANENSP00000340684STRING
AL3B2_HUMANENSP00000340684STRING
ADO_HUMANENSP00000340684STRING
TYRO_HUMANENSP00000340684STRING
DOPO_HUMANENSP00000340684STRING
SAT2_HUMANENSP00000340684STRING
PNMT_HUMANENSP00000340684STRING
HNMT_HUMANENSP00000340684STRING
SP1_HUMANENSP00000340684STRING
AL1A3_HUMANENSP00000340684STRING
- top -

Disease Reference
Kegg disease
H00548 Brunner syndrome; MAOA deficiency
OMIM disease
300615Brunner syndrome (BRUNS)
Drug Reference
Kegg drug
D00076 Noradrenaline (JP16); Norepinephrine (INN); Nor adrenalin (TN)
D00095 Adrenaline (JP16); Epinephrine (USP/INN); Adrenalin (TN); Auvi-q (TN); Epipen (TN)
D00346 Isoniazid (JP16/USP/INN); Laniazid (TN)
D00415 Zolmitriptan (JAN/USAN/INN); Zomig (TN)
D00451 Sumatriptan (JAN/USP/INN); Imigran (TN); Imitrex (TN)
D00505 Phenelzine sulfate (USP); Nardil (TN)
D00675 Rizatriptan benzoate (JAN/USAN); Maxalt (TN)
D00676 Sumatriptan succinate (JAN/USAN); Alsuma (TN); Imitrex (TN); Sumave dosepro (TN); Zecutity (TN)
D00826 Tranylcypromine sulfate (USP XXI); Parnate (TN)
D01304 Amezinium metilsulfate (JAN); Risumic (TN)
D01501 Isoniazid calcium pyruvinate (JAN); Pyruvic acid calcium isoniazid
D01888 Safrazine hydrochloride (JAN)
D02002 Isoniazid sodium methanesulfonate hydrate (JAN); Isoniazid sodium methanesulfonate monohydrate; Ison
D02559 Toloxatone (INN); Humoryl (TN)
D02560 Brofaromine (INN); Consonar (TN)
D02561 Moclobemide (USAN/INN); Aurorix (TN)
D02563 Befloxatone (INN)
D02564 Pargyline hydrochloride (USAN); Eutonyl (TN)
D02579 Iproniazid (INN)
D02580 Isocarboxazid (INN); Marplan (TN)
D02581 Cimoxatone (INN)
D03239 Ladostigil tartrate (USAN)
D03248 Clorgiline (INN); Clorgyline
D03409 Caroxazone (USAN/INN)
D04092 Etryptamine acetate (USAN)
D05039 Minaprine (USAN/INN); Cantor (TN)
D05040 Minaprine hydrochloride (USAN)
D07337 Nialamide (INN); Niamid (TN)
D07338 Iproclozide (INN); Iproclozide (TN)
D08085 Iproniazid phosphate; Marsilid (TN)
D08284 Norepinephrine hydrochoride; (-)-Noradrenaline hydrochloride; Arterenol (TN)
D08349 Phenelzine (BAN)
D08392 Pirlindole (INN); Pyrazidol (TN)
D08393 Pirlindole hydrochloride; Implementor (TN)
D08453 Pargyline (INN)
D08625 Tranylcypromine (INN); Parnate (TN)
D09773 Isoniazid glucuronate sodium (JAN)
D09794 Norepinephrine hydrochloride (JAN); (+/-)-Noradrenaline hydrochloride
DrugBank
DB00918Almotriptan
DB00988Dopamine
DB01363Ephedra
DB03147Flavin adenine dinucleotide
DB00614Furazolidone
DB01247Isocarboxazid
DB00601Linezolid
DB01577Methamphetamine
DB00805Minaprine
DB01171Moclobemide
DB08804Nandrolone decanoate
DB00952Naratriptan
DB00184Nicotine
DB01626Pargyline
DB00780Phenelzine
DB00191Phentermine
DB00388Phenylephrine
DB00397Phenylpropanolamine
DB00721Procaine
DB00852Pseudoephedrine
DB00140Riboflavin
DB00953Rizatriptan
DB01037Selegiline
DB01104Sertraline
DB00669Sumatriptan
DB00624Testosterone
DB00752Tranylcypromine
DB00315Zolmitriptan
DB00909Zonisamide
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"High-level expression of human liver monoamine oxidase A in Pichiapastoris: comparison with the enzyme expressed in Saccharomycescerevisiae.";
Li M., Hubalek F., Newton-Vinson P., Edmondson D.E.;
Protein Expr. Purif. 24:152-162(2002).
Cited for: PARTIAL PROTEIN SEQUENCE, ACETYLATION AT MET-1, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures