Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Amine oxidase [flavin-containing] A  

UniProtKB / Swiss-Prot ID :  AOFA_RAT

Gene Name (Synonyms) : 
Maoa  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. 

Protein Function :  Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOA preferentially oxidizes biogenic amines such as 5-hydroxytryptamine (5-HT), norepinephrine and epinephrine. 

Transmembrane Topology (topPTM) : AOFA_RAT 

Protein Sequence MTDLEKPNLAGHMFDVGLIGGGISGLAAAKLLSEYKINVLVLEARDRVGGRTYTVRNEHVKWVDVGGAYV...
Predicted Secondary Structure CCCCCCCCCCCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEEECCCCCEEEECCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
406S-8alpha-FAD cysteine.YSGGCYTAY
CCCCCEEEE
2.88UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures