Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Amine oxidase [flavin-containing] B  

UniProtKB / Swiss-Prot ID :  AOFB_HUMAN

Gene Name (Synonyms) : 
MAOB  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion outer membrane; Single-pass type IV membrane protein; Cytoplasmic side. 

Protein Function :  Catalyzes the oxidative deamination of biogenic and xenobiotic amines and has important functions in the metabolism of neuroactive and vasoactive amines in the central nervous system and peripheral tissues. MAOB preferentially degrades benzylamine and phenylethylamine. 

Transmembrane Topology (topPTM) : AOFB_HUMAN 

Protein Sequence MSNKCDVVVVGGGISGMAAAKLLHDSGLNVVVLEARDRVGGRTYTLRNQKVKYVDLGGSYVGPTQNRILR...
Predicted Secondary Structure CCCCCCEEEECCCHHHHHHHHHHHHCCCCEEEEECCCCCCCEEEEEECCCCEEEECCCCEECCCCHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine.---MSNKCD
---CCCCCC
45.02UniProtKB
Link
52Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NQKVKYVDL
CCCCEEEEC
46.74Phosphositeplus
Link
73Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LRLAKELGL
HHHHHHHCC
59.05Phosphositeplus
Link
81Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LETYKVNEV
CCEEEECCC
46.10Phosphositeplus
Link
136Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DAPWKAPLA
HHHHCCHHH
38.78Phosphositeplus
Link
230Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GDRVKLERP
CCEEEECCE
45.59Phosphositeplus
Link
397S-8alpha-FAD cysteine.YSGGCYTTY
CCCCEEEEE
2.88UniProtKB
Link
456Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HAMGKIPED
HHHCCCCHH
41.84Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
AOFB_HUMANin vitroHPRD:02401HPRD12913124
15027868
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D00095 Adrenaline (JP16); Epinephrine (USP/INN); Adrenalin (TN); Auvi-q (TN); Epipen (TN)
D00346 Isoniazid (JP16/USP/INN); Laniazid (TN)
D00505 Phenelzine sulfate (USP); Nardil (TN)
D00633 Dopamine hydrochloride (JP16/USP); Actopamin (TN); Intropin (TN)
D00785 Selegiline hydrochloride (JAN/USP); Eldepryl (TN)
D00826 Tranylcypromine sulfate (USP XXI); Parnate (TN)
D01097 Lazabemide hydrochloride (JAN/USAN); Tempium (TN)
D01304 Amezinium metilsulfate (JAN); Risumic (TN)
D01501 Isoniazid calcium pyruvinate (JAN); Pyruvic acid calcium isoniazid
D01888 Safrazine hydrochloride (JAN)
D02002 Isoniazid sodium methanesulfonate hydrate (JAN); Isoniazid sodium methanesulfonate monohydrate; Ison
D02562 Rasagiline mesylate (USAN); Azilect (TN)
D02564 Pargyline hydrochloride (USAN); Eutonyl (TN)
D02579 Iproniazid (INN)
D02580 Isocarboxazid (INN); Marplan (TN)
D03239 Ladostigil tartrate (USAN)
D03409 Caroxazone (USAN/INN)
D03731 Selegiline (USAN/INN); Emsam (TN)
D03733 Mofegiline hydrochloride (USAN)
D04092 Etryptamine acetate (USAN)
D04681 Lazabemide (USAN/INN)
D05033 Milacemide hydrochloride (USAN)
D07337 Nialamide (INN); Niamid (TN)
D07338 Iproclozide (INN); Iproclozide (TN)
D07870 Dopamine (INN); Medopa (TN)
D08085 Iproniazid phosphate; Marsilid (TN)
D08349 Phenelzine (BAN)
D08453 Pargyline (INN)
D08469 Rasagiline (USAN/INN); Azilect (TN)
D08625 Tranylcypromine (INN); Parnate (TN)
D09773 Isoniazid glucuronate sodium (JAN)
D10158 Safinamide (USAN/INN)
D10191 Safinamide mesylate (USAN)
DrugBank
DB00915Amantadine
DB00182Amphetamine
DB00988Dopamine
DB01363Ephedra
DB03147Flavin adenine dinucleotide
DB00614Furazolidone
DB01247Isocarboxazid
DB00601Linezolid
DB01577Methamphetamine
DB01171Moclobemide
DB08804Nandrolone decanoate
DB00184Nicotine
DB01626Pargyline
DB00780Phenelzine
DB00191Phentermine
DB00721Procaine
DB01367Rasagiline
DB01037Selegiline
DB01104Sertraline
DB00752Tranylcypromine
DB00909Zonisamide
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"High-level expression of human liver monoamine oxidase B in Pichiapastoris.";
Newton-Vinson P., Hubalek F., Edmondson D.E.;
Protein Expr. Purif. 20:334-345(2000).
Cited for: PROTEIN SEQUENCE OF 2-17, ACETYLATION AT SER-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures