Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  AP-1 complex subunit mu  

UniProtKB / Swiss-Prot ID :  AP1M_DICDI

Gene Name (Synonyms) : 
apm1 DDB_G0289247  

Species :  Dictyostelium discoideum (Slime mold). 

Subcellular Localization :  Golgi apparatus, trans-Golgi network. Cytoplasmic vesicle, clathrin-coated vesicle membrane (By similarity). 

Protein Function :  Subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules. Also involved in early steps of phagocytosis and macropinocytosis. 

Protein Sequence MAASAIFLMDSKGKVLISRNYRGDVPMSVASKFISKILEEEDLNLKPIIQEDGISYIYVKHNNLFLLATT...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine; partial.---MAASAI
---
15.32UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures