Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Bis(5'-nucleosyl)-tetraphosphatase [asymmetrical]  

UniProtKB / Swiss-Prot ID :  AP4A_HUMAN

Gene Name (Synonyms) : 
NUDT2, APAH1  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Asymmetrically hydrolyzes Ap4A to yield AMP and ATP. Plays a major role in maintaining homeostasis. 

Protein Sequence MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQL...
Predicted Secondary Structure CCCCCCCHHHHHCEEEECCCCCEEEEEEEEECCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHCCCCCCE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MALRAC
---CCCCCC
13.02UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GUC2F_HUMANENSP00000344187STRING
NDK3_HUMANENSP00000344187STRING
NDKM_HUMANENSP00000344187STRING
GUC2D_HUMANENSP00000344187STRING
GUC2C_HUMANENSP00000344187STRING
GCYB1_HUMANENSP00000344187STRING
NDK5_HUMANENSP00000344187STRING
KPYR_HUMANENSP00000344187STRING
ENTP3_HUMANENSP00000344187STRING
NDK6_HUMANENSP00000344187STRING
CANT1_HUMANENSP00000344187STRING
KPYM_HUMANENSP00000344187STRING
KPYM_HUMANENSP00000344187STRING
NDKA_HUMANENSP00000344187STRING
ANPRB_HUMANENSP00000344187STRING
ENTP8_HUMANENSP00000344187STRING
ENTP8_HUMANENSP00000344187STRING
PYRG2_HUMANENSP00000344187STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures