Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Adenine phosphoribosyltransferase  

UniProtKB / Swiss-Prot ID :  APT_HUMAN

Gene Name (Synonyms) : 
APRT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis. 

Protein Sequence MADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFL...
Predicted Secondary Structure CCCHHHHHHHHHHHHCCCCCCCCEEEEECCHHHCCHHHHHHHHHHHHHHHHHHCCCCEEEEEEECCCCHH...
Protein Variant
LocationDescription
65D -> V (in APRTD; Icelandic type). VAR_006747
110L -> P (in APRTD; Newfoundland type). VAR_006748
121Q -> R (in dbSNP:rs8191494). VAR_019055
136M -> T (in APRTD; Japanese type; alleleAPRT*J; most common mutation;
150V -> F (in APRTD). VAR_022608
153C -> R (in APRTD). VAR_022609
173Missing (in APRTD). VAR_037575
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADSEL
---CCCHHH
29.09UniProtKB
Link
4Phosphoserine-MADSELQL
-CCCHHHHH
30.57Phosphositeplus
Link
4Phosphoserine.-MADSELQL
-CCCHHHHH
30.57UniProtKB
Link
15PhosphoserineQRIRSFPDF
HHHHHCCCC
38.47Phosphositeplus
Link
15Phosphoserine.QRIRSFPDF
HHHHHCCCC
38.47UniProtKB
Link
30PhosphoserineFRDISPVLK
EEECCHHHC
17.16Phosphositeplus
Link
30Phosphoserine.FRDISPVLK
EEECCHHHC
17.16UniProtKB
Link
34Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SPVLKDPAS
CHHHCCHHH
63.00Phosphositeplus
Link
60PhosphotyrosineGRIDYIAGL
CCEEEEEEE
7.12Phosphositeplus
Link
60Phosphotyrosine.GRIDYIAGL
CCEEEEEEE
7.12UniProtKB
Link
66PhosphoserineAGLDSRGFL
EEECCCCHH
39.07Phosphositeplus
Link
66Phosphoserine.AGLDSRGFL
EEECCCCHH
39.07UniProtKB
Link
100Phosphoserine.TLWASYSLE
EEEEEEEEE
12.04UniProtKB
Link
114Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LEIQKDALE
EEEEECCCC
51.10Phosphositeplus
Link
114N6-acetyllysineLEIQKDALE
EEEEECCCC
51.10HPRD
Link
114N6-acetyllysineLEIQKDALE
EEEEECCCC
51.10Phosphositeplus
Link
114N6-acetyllysine.LEIQKDALE
EEEEECCCC
51.10UniProtKB
Link
135PhosphothreonineATGGTMNAA
HHHHHHHHH
14.48Phosphositeplus
Link
135Phosphothreonine.ATGGTMNAA
HHHHHHHHH
14.48UniProtKB
Link
167Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KGREKLAPV
CHHHHHCCC
48.89Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
APT_HUMANin vitroHPRD:00029HPRD15196008
- top -

Disease Reference
Kegg disease
OMIM disease
614723Adenine phosphoribosyltransferase deficiency (APRTD)
Drug Reference
DrugBank
DB00173Adenine
DB00131Adenosine monophosphate
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-114, AND MASS SPECTROMETRY.
"Exploring proteomes and analyzing protein processing by massspectrometric identification of sorted N-terminal peptides.";
Gevaert K., Goethals M., Martens L., Van Damme J., Staes A.,Thomas G.R., Vandekerckhove J.;
Nat. Biotechnol. 21:566-569(2003).
Cited for: PROTEIN SEQUENCE OF 2-12, AND ACETYLATION AT ALA-2.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
Phosphorylation
ReferencePubMed
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-66, AND MASSSPECTROMETRY.
"Large-scale proteomics analysis of the human kinome.";
Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G.,Mann M., Daub H.;
Mol. Cell. Proteomics 8:1751-1764(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-4; SER-15; SER-30;TYR-60; SER-66; SER-100 AND THR-135, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures