Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Arfaptin-1  

UniProtKB / Swiss-Prot ID :  ARFP1_HUMAN

Gene Name (Synonyms) : 
ARFIP1  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Putative target protein of ADP-ribosylation factor. 

Protein Sequence MAQESPKNSAAEIPVTSNGEVDDSREHSFNRDLKHSLPSGLGLSETQITSHGFDNTKEGVIEAGAFQGSP...
Predicted Secondary Structure CCCCCCCCCCEECCCCCCCCCCCHHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5PhosphoserineMAQESPKNS
CCCCCCCCC
29.15HPRD
Link-
5PhosphoserineMAQESPKNS
CCCCCCCCC
29.15Phosphositeplus
Link-
24PhosphoserineEVDDSREHS
CCCCHHHHH
34.80HPRD
Link-
24PhosphoserineEVDDSREHS
CCCCHHHHH
34.80Phosphositeplus
Link-
28PhosphoserineSREHSFNRD
HHHHHHHHH
21.33HPRD
Link-
36PhosphoserineDLKHSLPSG
HHHHHHCCC
40.15HPRD
Link-
36PhosphoserineDLKHSLPSG
HHHHHHCCC
40.15Phosphositeplus
Link-
39PhosphoserineHSLPSGLGL
HHHCCCCCC
52.52HPRD
Link-
39PhosphoserineHSLPSGLGL
HHHCCCCCC
52.52Phosphositeplus
Link-
69PhosphoserineAFQGSPAPP
CCCCCCCCC
13.70HPRD
Link-
69PhosphoserineAFQGSPAPP
CCCCCCCCC
13.70PhosphoELM
Link-
69PhosphoserineAFQGSPAPP
CCCCCCCCC
13.70Phosphositeplus
Link-
69PhosphoserineAFQGSPAPP
CCCCCCCCC
13.70SysPTM
Link-
69Phosphoserine.AFQGSPAPP
CCCCCCCCC
13.70UniProtKB
Link-
76PhosphoserinePPLPSVMSP
CCCCCCCCC
37.83HPRD
Link-
76PhosphoserinePPLPSVMSP
CCCCCCCCC
37.83PhosphoELM
Link-
79PhosphoserinePSVMSPSRV
CCCCCCHHH
19.98HPRD
Link-
79PhosphoserinePSVMSPSRV
CCCCCCHHH
19.98PhosphoELM
Link-
79PhosphoserinePSVMSPSRV
CCCCCCHHH
19.98Phosphositeplus
Link-
79PhosphoserinePSVMSPSRV
CCCCCCHHH
19.98SysPTM
Link-
79Phosphoserine.PSVMSPSRV
CCCCCCHHH
19.98UniProtKB
Link-
93PhosphoserineAQQGSDLIV
HHCCCCCCC
25.55HPRD
Link-
93PhosphoserineAQQGSDLIV
HHCCCCCCC
25.55Phosphositeplus
Link-
118Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ADEIKNPAM
CCCCCCHHH
55.63Phosphositeplus
Link-
132PhosphoserineVRKWSLNTY
HHHHHHHHH
18.12HPRD
Link-
132PhosphoserineVRKWSLNTY
HHHHHHHHH
18.12PhosphoELM
Link-
132PhosphoserineVRKWSLNTY
HHHHHHHHH
18.12Phosphositeplus
Link-
132PhosphoserineVRKWSLNTY
HHHHHHHHH
18.12SysPTM
Link-
132Phosphoserine.VRKWSLNTY
HHHHHHHHH
18.12UniProtKB
Link-
253PhosphothreonineTIEDTLMTV
HHHHHHHHH
12.97HPRD
Link-
272PhosphothreonineDAYRTDLEE
HHHHHHHHH
32.06Phosphositeplus
Link-
272Phosphothreonine.DAYRTDLEE
HHHHHHHHH
32.06UniProtKB
Link-
353Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EQTLKQFHI
HHHHHHCCE
55.06Phosphositeplus
Link-
361PhosphothreonineIKLKTPGVD
EECCCCCCC
35.39Phosphositeplus
Link-
361Phosphothreonine.IKLKTPGVD
EECCCCCCC
35.39UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ARF1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:09331HPRD9038142
ARF3_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:09331HPRD10413101
9038142
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"A quantitative atlas of mitotic phosphorylation.";
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E.,Elledge S.J., Gygi S.P.;
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-69; SER-79 AND SER-132,AND MASS SPECTROMETRY.
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, AND MASSSPECTROMETRY.
"Quantitative phosphoproteomic analysis of T cell receptor signalingreveals system-wide modulation of protein-protein interactions.";
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K.,Rodionov V., Han D.K.;
Sci. Signal. 2:RA46-RA46(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-272 AND THR-361, ANDMASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures