Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Acetylornithine aminotransferase  

UniProtKB / Swiss-Prot ID :  ARGD_THEMA

Gene Name (Synonyms) : 
argD TM_1785  

Species :  Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099). 

Subcellular Localization :  Cytoplasm (Probable). 

Protein Function :   

Protein Sequence MYLMNTYSRFPATFVYGKGSWIYDEKGNAYLDFTSGIAVNVLGHSHPRLVEAIKDQAEKLIHCSNLFWNR...
Predicted Secondary Structure CEECCCCCCCCCEEEECCCCEEEECCCCEEEHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHCCCCCCCH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
240N6-(pyridoxal phosphate)lysine.LTTAKGLGG
EEEHHHHHC
53.21UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures