Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Arylamine N-acetyltransferase 1  

UniProtKB / Swiss-Prot ID :  ARY1_HUMAN

Gene Name (Synonyms) : 
NAT1, AAC1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Participates in the detoxification of a plethora of hydrazine and arylamine drugs. Catalyzes the N- or O-acetylation of various arylamine and heterocyclic amine substrates and is able to bioactivate several known carcinogens. 

Protein Sequence MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQ...
Predicted Secondary Structure CCHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEE...
Protein Variant
LocationDescription
64R -> W (in allele NAT1*17; a slowacetylator; has defective enzyme
117R -> T (in allele NAT1*5;dbSNP:rs55641436).
149V -> I (in allele NAT1*11; catalyzes theN-acetylation of aromatic amines and the
166RE -> TQ (in allele NAT1*5). VAR_009511
187R -> Q (in allele NAT1*14; a slowacetylator; dbSNP:rs4986782).
205M -> V (in allele NAT1*21). VAR_009070
207T -> I (in dbSNP:rs4987195). VAR_020384
214S -> A (in allele NAT1*11;dbSNP:rs4986783).
251D -> V (in allele NAT1*22;dbSNP:rs56172717).
261E -> K (in allele NAT1*24). VAR_009073
263I -> V (in allele NAT1*25). VAR_009074
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25PhosphothreonineLETLTDILQ
HHHHHHHHH
28.54HPRD
Link
68N-acetylcysteineRGGWCLQVN
CCCEEEEHH
1.84HPRD
Link
101PhosphotyrosinePAKKYSTGM
CCCCCCCCC
15.68Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB01015Sulfamethoxazole
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures