Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Autophagy-related protein 8  

UniProtKB / Swiss-Prot ID :  ATG8_YEAST

Gene Name (Synonyms) : 
ATG8, APG8, AUT7, CVT5 YBL078CYBL0732  

Species :  Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast). 

Subcellular Localization :  Cytoplasmic vesicle, cvt vesicle membrane; Lipid-anchor. Cytoplasmic vesicle, autophagosome membrane; Lipid- anchor. Vacuole membrane; Lipid-anchor. Note=Membrane-associated through a lipid anchor. This association needs the 2 ubiquitin- like systems req 

Protein Function :  Involved in cytoplasm to vacuole transport (Cvt) vesicles and autophagosomes formation. With ATG4, may mediate the delivery of the vesicles and autophagosomes to the vacuole via the microtubule cytoskeleton. Participates also in membrane fusion events that take place in the early secretory pathway. 

Protein Sequence MKSTFKSEYPFEKRKAESERIADRFKNRIPVICEKAEKSDIPEIDKRKYLVPADLTVGQFVYVIRKRIML...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCCCCEEEECCCCCCHHHHHHHHHHHHCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
116Phosphatidylethanolamine amidated glycine.ENTFGR
CCCCCC
32.14UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Lipoprotein
ReferencePubMed
"A ubiquitin-like system mediates protein lipidation.";
Ichimura Y., Kirisako T., Takao T., Satomi Y., Shimonishi Y.,Ishihara N., Mizushima N., Tanida I., Kominami E., Ohsumi M., Noda T.,Ohsumi Y.;
Nature 408:488-492(2000).
Cited for: FUNCTION, INTERACTION WITH ATG3 AND ATG7, AND LIPIDATION.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures