Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Tyrosine aminotransferase  

UniProtKB / Swiss-Prot ID :  ATTY_HUMAN

Gene Name (Synonyms) : 
TAT  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Transaminase involved in tyrosine breakdown. Converts tyrosine to p-hydroxyphenylpyruvate. Can catalyze the reverse reaction, using glutamic acid, with 2-oxoglutarate as cosubstrate (in vitro). Has no transaminase activity towards phenylalanine. 

Protein Sequence MDPYMIQMSSKGNLPSILDVHVNVGGRSSVPGKMKGRKARWSVRPSDMAKKTFNPIRAIVDNMKVKPNPN...
Predicted Secondary Structure CCCEEEEECCCCCCCCEEECCCCCCCCEECCHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCC...
Protein Variant
LocationDescription
70N -> D (in dbSNP:rs16973344). VAR_048226
362G -> V (in TYRO2; dbSNP:rs28934277). VAR_000560
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
33N6-acetyllysineSVPGKMKGR
ECCHHHHHH
31.22Phosphositeplus
Link-
280N6-(pyridoxal phosphate)lysine.GGLAKRWLV
ECCHHHCCC
49.50UniProtKB
Link
448PhosphoserineCAEGSQEEC
CCCCCHHHC
26.39HPRD
Link-
448PhosphoserineCAEGSQEEC
CCCCCHHHC
26.39Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
MIF_HUMANENSP00000348234STRING
PERE_HUMANENSP00000348234STRING
AATM_HUMANENSP00000348234STRING
AATM_HUMANENSP00000348234STRING
INS_HUMANENSP00000348234STRING
INS_HUMANENSP00000348234STRING
CCNT1_HUMANENSP00000348234STRING
PERL_HUMANENSP00000348234STRING
EP300_HUMANENSP00000348234STRING
TYRO_HUMANENSP00000348234STRING
SYFB_HUMANENSP00000348234STRING
HPPD_HUMANENSP00000348234STRING
PH4H_HUMANENSP00000348234STRING
SYFM_HUMANENSP00000348234STRING
SYFA_HUMANENSP00000348234STRING
SYYM_HUMANENSP00000348234STRING
PERT_HUMANENSP00000348234STRING
- top -

Disease Reference
Kegg disease
OMIM disease
276600Tyrosinemia 2 (TYRSN2)
Drug Reference
DrugBank
DB00120L-Phenylalanine
DB00135L-Tyrosine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures