Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Avidin-related protein 4/5  

UniProtKB / Swiss-Prot ID :  AVR4_CHICK

Gene Name (Synonyms) : 
AVR4
AVR5  

Species :  Gallus gallus (Chicken). 

Subcellular Localization :  Secreted (Potential). 

Protein Function :   

Protein Sequence MVHTTSPLLLLLLLSLALVAPSLSARKCSLTGKWTNNLGSIMTIRAVNSRGEFTGTYLTAVADNPGNITL...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHCCCCCHHHCCCEEEEECCCCCEEEEEEECCCCEEECEEEEEECCCCCCEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
67N-linked (GlcNAc...).DNPGNITLS
CCCCCEEEE
25.90UniProtKB
Link
141N-linked (GlcNAc...).VGYNNFTRL
CCCCCCEEE
31.05UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"High-resolution crystal structure of an avidin-related protein:insight into high-affinity biotin binding and protein stability.";
Eisenberg-Domovich Y., Hytoenen V.P., Wilchek M., Bayer E.A.,Kulomaa M.S., Livnah O.;
Acta Crystallogr. D 61:528-538(2005).
Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS) OF 25-150, DISULFIDE BOND, ANDGLYCOSYLATION AT ASN-67 AND ASN-141.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures