Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Carbohydrate-binding protein AWN  

UniProtKB / Swiss-Prot ID :  AWN_PIG

Gene Name (Synonyms) :  -
 

Species :  Sus scrofa (Pig). 

Subcellular Localization :  Secreted. Note=Predominantly localized on the membrane overlying the acrosomal cap region of the sperm head. 

Protein Function :  AWN proteins mediate the binding of boar spermatozoa to component(s) of the egg's zona pellucida by a carbohydrate-binding mechanism. Awn proteins are secretory components of the male accessory glands being coated to the sperm surface at the time of ejaculation. They possess as well heparin-, serine-protease- inhibitor-binding capability. 

Protein Sequence MKLAAPSLALLLSTATLVSGAWNRRSRSCGGVLRDPPGKIFNSDGPQKDCVWTIKVKPHFHVVLAIPPLN...
Predicted Secondary Structure CCCCCCCHHHEEECCCCEECCCCCCCCCCCCEEECCEEEEECCCCCCCCEEEEEEECCCCEEEEEEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
21N-acetylalanine.LVSGAWNRR
CEECCCCCC
7.89UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The complete primary structure of the spermadhesin AWN, a zonapellucida-binding protein isolated from boar spermatozoa.";
Sanz L., Calvete J.J., Mann K., Schaefer W., Schmid E.R.,Amselgruber W., Sinowatz F., Ehrhard M., Toepfer-Petersen E.;
FEBS Lett. 300:213-218(1992).
Cited for: PROTEIN SEQUENCE OF 21-153, AND DISULFIDE BONDS.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures