Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Beta-secretase 1  

UniProtKB / Swiss-Prot ID :  BACE1_HUMAN

Gene Name (Synonyms) : 
BACE1, BACE, KIAA1149  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Single-pass type I membrane protein. Golgi apparatus, trans-Golgi network. Endoplasmic reticulum. Endosome. Cell surface. Cytoplasmic vesicle membrane. Note=Predominantly localized to the later Golgi/trans-Golgi network (TGN) and minimally dete 

Protein Function :  Responsible for the proteolytic processing of the amyloid precursor protein (APP). Cleaves at the N-terminus of the A-beta peptide sequence, between residues 671 and 672 of APP, leads to the generation and extracellular release of beta-cleaved soluble APP, and a corresponding cell-associated C-terminal fragment which is later released by gamma-secretase. 

Transmembrane Topology (topPTM) : BACE1_HUMAN 

Protein Sequence MAQALPWLLLWMGAGVLPAHGTQHGIRLPLRSGLGGAPLGLRLPRETDEEPEEPGRRGSFVEMVDNLRGK...
Predicted Secondary Structure CCCCCCEEEEECCCCCCCCCCCCCEEEEEEEECCCHHHHHHHCCHHHHHHCCCHHHCCCCEEEECCCCCC...
Protein Variant
LocationDescription
265V -> A. VAR_060692
481C -> R (in dbSNP:rs539765). VAR_051509
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
46noneRLPRETDEE
HCCHHHHHH
59.68HPRD
Link
126N6-acetyllysineRDLRKGVYV
EECCEEEEE
61.09Phosphositeplus
Link
153N-linked (Glc...)PHGPNVTVR
CCCCCEEEC
46.84HPRD
Link
172N-linked (Glc...)KFFINGSNW
CCEEECCCC
42.56HPRD
Link
216S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)SLQLCGAGF
EEEECCCCC
1.96HPRD
Link
223N-linked (Glc...)GFPLNQSEV
CCCCCCCCC
43.50HPRD
Link
275N6-acetyllysineGQDLKMDCK
CEEEEECCC
40.77Phosphositeplus
Link
278S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)LKMDCKEYN
EEECCCCCC
3.01HPRD
Link
279N6-acetyllysineKMDCKEYNY
EECCCCCCC
59.99Phosphositeplus
Link
285N6-acetyllysineYNYDKSIVD
CCCCEEEEE
31.55Phosphositeplus
Link
299N6-acetyllysineLRLPKKVFE
EECHHHHHH
67.19Phosphositeplus
Link
300N6-acetyllysineRLPKKVFEA
ECHHHHHHH
50.66Phosphositeplus
Link
307N6-acetyllysineEAAVKSIKA
HHHHHHHCC
41.56Phosphositeplus
Link
330S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)EQLVCWQAG
EEEECCCCC
2.79HPRD
Link
354N-linked (Glc...)GEVTNQSFR
CEECCCCEE
40.45HPRD
Link
380S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)SQDDCYKFA
EECEEEEEC
5.53HPRD
Link
420S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)AVSACHVHD
EEHHCCCCC
2.41HPRD
Link-
443S-cysteinyl 3-(oxidosulfanyl)alanine (Cys-Cys)DMEDCGYNI
CCCCCCCCC
3.87HPRD
Link-
498PhosphoserineADDISLLK
HHHHHHCC
34.34Phosphositeplus
Link-
498Phosphoserine (CK1_alpha;CK1_delta)ADDISLLK
HHHHHHCC
34.34PhosphoELM
Link-
498Phosphoserine (CSNK1D)ADDISLLK
HHHHHHCC
34.34HPRD
Link-
501Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ISLLK
HHHCC
64.68Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PSN1_HUMANphysical interactionMINT-19408MINT12901838
PSN1_HUMANphysical interactionMINT-19407MINT12901838
PSN1_HUMANphysical interactionMINT-19406MINT12901838
PSN1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:07255HPRD12901838
MMP2_HUMANin vitroHPRD:07255HPRD12586836
A4_HUMANin vitroHPRD:07255HPRD10531052
NICA_HUMANin vitro
in vivo
HPRD:07255HPRD12054507
FUBP2_HUMANyeast 2-hybridHPRD:07255HPRD15606899
KCY_HUMANyeast 2-hybridHPRD:07255HPRD15606899
SAP_HUMANyeast 2-hybridHPRD:07255HPRD15606899
PDIA3_HUMANyeast 2-hybridHPRD:07255HPRD15606899
RANB9_HUMANyeast 2-hybridHPRD:07255HPRD15606899
SELPL_HUMANin vitroHPRD:07255HPRD14507929
PLS1_HUMANin vitro
in vivo
yeast 2-hybrid
HPRD:07255HPRD12586838
BRI3_HUMANin vivo
yeast 2-hybrid
HPRD:07255HPRD15606899
LRP1_HUMANin vivoHPRD:07255HPRD15749709
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures