Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Beta-glucuronidase  

UniProtKB / Swiss-Prot ID :  BGLR_HUMAN

Gene Name (Synonyms) : 
GUSB  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Lysosome. 

Protein Function :  Plays an important role in the degradation of dermatan and keratan sulfates. 

Protein Sequence MARGSAVAWAALGPLLWGCALGLQGGMLYPQESPSRECKELDGLWSFRADFSDNRRRGFEEQWYRRPLWE...
Predicted Secondary Structure CCCCCEEEEEEHHHHHHHHHHHCCCCCCCCCCCCCCEEEECCCCEEEECCCCCCCCCCCCCCHHHHHHHC...
Protein Variant
LocationDescription
30P -> S (in MPS7). VAR_058511
38C -> G (in MPS7; very mild phenotype). VAR_037914
52S -> F (in MPS7; loss of activity). VAR_037915
136G -> R (in MPS7). VAR_037916
148P -> S (in MPS7). VAR_037917
150E -> K (in MPS7). VAR_037918
152D -> G (in MPS7). VAR_058512
152D -> N (reduced activity levels withoutapparent pathogenic consequences).
176L -> F (in MPS7). VAR_037920
216R -> W (in MPS7). VAR_003196
243L -> P (in MPS7). VAR_058513
320Y -> C (in MPS7). VAR_037921
320Y -> S (in MPS7). VAR_037922
339N -> S (in MPS7). VAR_058514
350K -> N (in MPS7). VAR_037923
351H -> Y (in MPS7). VAR_037924
354A -> V (in MPS7). VAR_003197
361Missing (in MPS7). VAR_058515
362D -> N (in MPS7). VAR_058516
364P -> L (in MPS7). VAR_058517
374R -> C (in MPS7). VAR_037925
376L -> F (in dbSNP:rs11559283). VAR_055884
382R -> C (in MPS7). VAR_003198
382R -> H (in MPS7). VAR_037926
408P -> S (in MPS7). VAR_037927
415P -> L (in MPS7). VAR_037928
435R -> P (in MPS7). VAR_037929
477R -> W (in MPS7). VAR_037930
495Y -> C (in MPS7). VAR_037931
508Y -> C (in MPS7). VAR_037932
540E -> K (in MPS7). VAR_058518
572G -> D (in MPS7). VAR_037933
577R -> L (in MPS7; loss of activity). VAR_037934
606K -> N (in MPS7). VAR_037935
607G -> A (in MPS7). VAR_058519
611R -> W (in MPS7). VAR_003199
619A -> V (in MPS7). VAR_003200
626Y -> H (in MPS7; very mild phenotype). VAR_037936
627W -> C (in MPS7). VAR_003201
649L -> P (in dbSNP:rs9530). VAR_016179
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
39Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SRECKELDG
CCEEEECCC
57.46Phosphositeplus
Link
173N-linked (Glc...)TIAINNTLT
EEEECCCCC
26.81HPRD
Link
173N-linked (GlcNAc...).TIAINNTLT
EEEECCCCC
26.81UniProtKB
Link
272N-linked (Glc...)KVVANGTGT
EEEEECCCC
36.63HPRD
Link
272N-linked (GlcNAc...).KVVANGTGT
EEEEECCCC
36.63UniProtKB
Link
274PhosphothreonineVANGTGTQG
EEECCCCCC
36.54HPRD
Link
274PhosphothreonineVANGTGTQG
EEECCCCCC
36.54PhosphoELM
Link
359Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DIRGKGFDW
CCCCCCCCH
46.70Phosphositeplus
Link
368Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PLLVKDFNL
HHHHHHHHH
57.48Phosphositeplus
Link
420N-linked (Glc...)QFFNNVSLH
CCCCCCCCH
21.43HPRD
Link
420N-linked (GlcNAc...).QFFNNVSLH
CCCCCCCCH
21.43UniProtKB
Link
631N-linked (Glc...)WKIANETRY
HHHHHHCCC
55.43HPRD
Link
631N-linked (GlcNAc...).WKIANETRY
HHHHHHCCC
55.43UniProtKB
Link
641Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)HSVAKSQCL
CCCCEEEEC
38.61Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TPP1_HUMANcolocalizationMINT-4054731MINT17174955
A2MG_HUMANcolocalizationMINT-4054731MINT17174955
GLCM_HUMANcolocalizationMINT-4054731MINT17174955
G3P_HUMANcolocalizationMINT-4054731MINT17174955
APOD_HUMANcolocalizationMINT-4054731MINT17174955
ADT2_HUMANcolocalizationMINT-4054731MINT17174955
PERM_HUMANcolocalizationMINT-4054731MINT17174955
PPB1_HUMANcolocalizationMINT-4054731MINT17174955
ATPB_HUMANcolocalizationMINT-4054731MINT17174955
CATG_HUMANcolocalizationMINT-4054731MINT17174955
CH60_HUMANcolocalizationMINT-4054731MINT17174955
GRP78_HUMANcolocalizationMINT-4054731MINT17174955
ADT3_HUMANcolocalizationMINT-4054731MINT17174955
KCRU_HUMANcolocalizationMINT-4054731MINT17174955
BGAL_HUMANcolocalizationMINT-4054731MINT17174955
CAP7_HUMANcolocalizationMINT-4054731MINT17174955
VATB2_HUMANcolocalizationMINT-4054731MINT17174955
AOFA_HUMANcolocalizationMINT-4054731MINT17174955
VDAC1_HUMANcolocalizationMINT-4054731MINT17174955
PRTN3_HUMANcolocalizationMINT-4054731MINT17174955
ATPA_HUMANcolocalizationMINT-4054731MINT17174955
ODO2_HUMANcolocalizationMINT-4054731MINT17174955
VATA_HUMANcolocalizationMINT-4054731MINT17174955
VA0D1_HUMANcolocalizationMINT-4054731MINT17174955
ASAH1_HUMANcolocalizationMINT-4054731MINT17174955
SCRB2_HUMANcolocalizationMINT-4054731MINT17174955
ARL8B_HUMANcolocalizationMINT-4054731MINT17174955
CAN6_HUMANcolocalizationMINT-4054731MINT17174955
EST1_HUMANin vitro
in vivo
HPRD:02018HPRD10562416
BGLR_HUMANin vitroHPRD:02018HPRD8505339
UDB10_HUMANENSP00000302728STRING
UDB10_HUMANENSP00000302728STRING
UD2A1_HUMANENSP00000302728STRING
UD2A1_HUMANENSP00000302728STRING
UDB11_HUMANENSP00000302728STRING
UDB11_HUMANENSP00000302728STRING
UD2B7_HUMANENSP00000302728STRING
UD2B7_HUMANENSP00000302728STRING
UD2B4_HUMANENSP00000302728STRING
UD2B4_HUMANENSP00000302728STRING
UDB15_HUMANENSP00000302728STRING
UDB15_HUMANENSP00000302728STRING
UDB17_HUMANENSP00000302728STRING
UDB17_HUMANENSP00000302728STRING
UD14_HUMANENSP00000302728STRING
UD14_HUMANENSP00000302728STRING
UDB28_HUMANENSP00000302728STRING
UDB28_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
EST1_HUMANENSP00000302728STRING
- top -

Disease Reference
Kegg disease
OMIM disease
253220Mucopolysaccharidosis 7 (MPS7)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Identification and quantification of N-linked glycoproteins usinghydrazide chemistry, stable isotope labeling and mass spectrometry.";
Zhang H., Li X.-J., Martin D.B., Aebersold R.;
Nat. Biotechnol. 21:660-666(2003).
Cited for: GLYCOSYLATION AT ASN-272.
"Human plasma N-glycoproteome analysis by immunoaffinity subtraction,hydrazide chemistry, and mass spectrometry.";
Liu T., Qian W.-J., Gritsenko M.A., Camp D.G. II, Monroe M.E.,Moore R.J., Smith R.D.;
J. Proteome Res. 4:2070-2080(2005).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-272, AND MASSSPECTROMETRY.
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-173; ASN-272 AND ASN-631,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures