Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Betaine--homocysteine S-methyltransferase 1  

UniProtKB / Swiss-Prot ID :  BHMT1_HUMAN

Gene Name (Synonyms) : 
BHMT  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Involved in the regulation of homocysteine metabolism. Converts betaine and homocysteine to dimethylglycine and methionine, respectively. This reaction is also required for the irreversible oxidation of choline. 

Protein Sequence MPPVGGKKAKKGILERLNAGEIVIGDGGFVFALEKRGYVKAGPWTPEAAVEHPEAVRQLHREFLRAGSNV...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHCCCCEEEEECHHHHHHHHCCCCCCCCCCCHHHCCCHHHHHHHHHHHHHHCCCE...
Protein Variant
LocationDescription
199G -> S (in dbSNP:rs59866108). VAR_061345
239R -> Q (may decrease risk for coronaryartery disease; dbSNP:rs3733890).
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
363PhosphotyrosineSGRPYNPSM
CCCCCCCCC
38.04Phosphositeplus
Link
369N6-acetyllysinePSMSKPDGW
CCCCCCCCC
38.19Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
BHMT1_HUMANphysical interactionMINT-68449MINT16189514
BHMT1_HUMANphysical interactionEBI-760354
intact16189514
BHMT1_HUMANin vitro
yeast 2-hybrid
HPRD:04200HPRD12071701
11223523
12220488
16189514
SAHH_HUMANENSP00000274353STRING
M2GD_HUMANENSP00000274353STRING
SYMC_HUMANENSP00000274353STRING
SYMM_HUMANENSP00000274353STRING
METK2_HUMANENSP00000274353STRING
SAHH3_HUMANENSP00000274353STRING
CHDH_HUMANENSP00000274353STRING
MAT2B_HUMANENSP00000274353STRING
CBS_HUMANENSP00000274353STRING
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00134L-Methionine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures