Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Serpin-Z7  

UniProtKB / Swiss-Prot ID :  BSZ7_HORVU

Gene Name (Synonyms) : 
PAZ7  

Species :  Hordeum vulgare (Barley). 

Subcellular Localization :   

Protein Function :  Inhibits chymotrypsin in vitro. 

Protein Sequence MATTLTTDLRLSIAHQTRFGLRLASAISSDPESAATNVAFSPVSLHVALSLVAAGARGATRDQLVAVLGG...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MATTLT
---
14.86UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Primary structure of the plant serpin BSZ7 having the capacity ofchymotrypsin inhibition.";
Rasmussen S.K., Klausen J., Hejgaard J., Svensson B., Svendsen I.;
Biochim. Biophys. Acta 1297:127-130(1996).
Cited for: NUCLEOTIDE SEQUENCE [MRNA], PROTEIN SEQUENCE OF 2-18; 23-46; 62-96;102-129; 107-131; 154-174; 175-184; 196-215; 206-236; 233-242;243-259; 246-268; 264-277; 286-293; 293-322; 320-335; 320-341;326-341; 359-377 AND 378-396, FUNCTION, AND ACETYLATION AT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures