Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  C-1-tetrahydrofolate synthase, cytoplasmic  

UniProtKB / Swiss-Prot ID :  C1TC_HUMAN

Gene Name (Synonyms) : 
MTHFD1, MTHFC, MTHFD  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :   

Protein Sequence MAPAEILNGKEISAQIRARLKNQVTQLKEQVPGFTPRLAILQVGNRDDSNLYINVKLKAAEEIGIKATHI...
Predicted Secondary Structure CCCCEECCHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEECCCHHHHHHHHHHHHHHHHCCCEEEEE...
Protein Variant
LocationDescription
134R -> K (associated with increased risk ofcolorectal cancer; dbSNP:rs1950902).
162P -> L (in dbSNP:rs4902283). VAR_055458
293R -> H (associated with susceptibility toFS-NTD; dbSNP:rs34181110).
653R -> Q (may be associated withsusceptibility to FS-NTD; decreases
761T -> M (in dbSNP:rs10813). VAR_032789
769L -> F (in dbSNP:rs17857382). VAR_032790
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25PhosphothreonineKNQVTQLKE
HHHHHHHHH
20.58HPRD
Link
25PhosphothreonineKNQVTQLKE
HHHHHHHHH
20.58Phosphositeplus
Link
28Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VTQLKEQVP
HHHHHHHCC
35.96Phosphositeplus
Link
56N6-acetyllysineYINVKLKAA
HHHHHHHHH
39.52HPRD
Link
262Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YDEAKERAS
HHHHHHHCC
45.76Phosphositeplus
Link
262N6-acetyllysineYDEAKERAS
HHHHHHHCC
45.76Phosphositeplus
Link
313Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)NLNLKTPVP
CCCCCCCCC
50.11Phosphositeplus
Link-
354Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ETKAKVLLS
CEEEEECHH
34.66Phosphositeplus
Link-
370Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RPDGKYVVV
CCCCCEEEE
42.10Phosphositeplus
Link-
471PhosphothreonineELTQTDKAL
HHHCCHHHH
33.94HPRD
Link-
473Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)TQTDKALFN
HCCHHHHHH
50.83Phosphositeplus
Link-
504Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LGIEKTDPT
CCCCCCCCH
57.20Phosphositeplus
Link-
553N6-acetyllysineAPTEKGHTR
CCCCCCEEE
59.47HPRD
Link-
553N6-acetyllysineAPTEKGHTR
CCCCCCEEE
59.47Phosphositeplus
Link-
553N6-acetyllysine.APTEKGHTR
CCCCCCEEE
59.47UniProtKB
Link-
588Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ERLGKMVVA
HHHHCEEEE
32.87Phosphositeplus
Link-
784Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FDAVKCTHW
CEEEEEHHH
34.83Phosphositeplus
Link-
819Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LYDLKLPVE
CCCCCCCHH
48.09Phosphositeplus
Link-
848Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EAQHKAEVY
HHHHHHHHH
33.88Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
C1TC_HUMANin vitroHPRD:01403HPRD10828945
9519408
FMT_HUMANENSP00000216605STRING
PUR9_HUMANENSP00000216605STRING
MTHFS_HUMANENSP00000216605STRING
FTHFD_HUMANENSP00000216605STRING
GCST_HUMANENSP00000216605STRING
TYSY_HUMANENSP00000216605STRING
GLYC_HUMANENSP00000216605STRING
AFMID_HUMANENSP00000216605STRING
GLYM_HUMANENSP00000216605STRING
- top -

Disease Reference
Kegg disease
OMIM disease
601634Neural tube defects, folate-sensitive (NTDFS)
114500Colorectal cancer (CRC)
Drug Reference
DrugBank
DB00116Tetrahydrofolic acid
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-553, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures