Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cationic amino acid transporter 1  

UniProtKB / Swiss-Prot ID :  CAAT1_ARATH

Gene Name (Synonyms) : 
CAT1, AAT1 At4g21120F7J7.60  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :  High-affinity permease involved in the transport of the cationic amino acids (e.g. arginine, lysine, histidine, citrulline, valine, and glutamate). Transport mostly basic amino- acids, and, to a lower extent neutral and acidic amino-acids. May function as a proton symporter. 

Transmembrane Topology (topPTM) : CAAT1_ARATH 

Protein Sequence MASGGGDDGLRRRGCSCTKDDFLPEESFQSMGNYLKALKETPSRFMDRIMTRSLDSDEINEMKARSGHEM...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures