Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Carbonic anhydrase 2  

UniProtKB / Swiss-Prot ID :  CAH2_HUMAN

Gene Name (Synonyms) : 
CA2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. 

Protein Function :  Essential for bone resorption and osteoclast differentiation (By similarity). Reversible hydration of carbon dioxide. Can hydrates cyanamide to urea. Involved in the regulation of fluid secretion into the anterior chamber of the eye. 

Protein Sequence MSHHWGYGKHNGPEHWHKDFPIAKGERQSPVDIDTHTAKYDPSLKPLSVSYDQATSLRILNNGHAFNVEF...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEECCCEEECCCCCCEEEECCCCCEEEEEECCEEEEEEE...
Protein Variant
LocationDescription
18K -> E (in Jogjakarta). VAR_001380
92Q -> P (in OPTB3; in Czechoslovakia). VAR_001381
94H -> Y (in OPTB3; partial loss ofactivity).
107H -> Y (in OPTB3; frequent mutation). VAR_001382
144G -> R (in OPTB3; complete loss ofactivity).
236P -> H (in Melbourne). VAR_001383
252N -> D (in dbSNP:rs2228063). VAR_001384
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylserine---MSHHWG
---CCCCCC
24.86HPRD
Link-
2N-acetylserine.---MSHHWG
---CCCCCC
24.86UniProtKB
Link-
18Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EHWHKDFPI
CCCCCCCCC
56.74Phosphositeplus
Link
39Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)THTAKYDPS
CCCEEECCC
51.87Phosphositeplus
Link
40PhosphotyrosineHTAKYDPSL
CCEEECCCC
30.53Phosphositeplus
Link
45Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DPSLKPLSV
CCCCCCEEE
48.53Phosphositeplus
Link
51PhosphotyrosineLSVSYDQAT
EEEECCCCC
15.21Phosphositeplus
Link
80Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)KAVLKGGPL
CCEEECCCC
56.05Phosphositeplus
Link
114PhosphotyrosineDKKKYAAEL
CCEEEEEEE
21.66Phosphositeplus
Link
158Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PGLQKVVDV
CHHHHHHHH
49.63Phosphositeplus
Link
224Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)EQVLKFRKL
HHHHHHHHH
44.24Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PTHD2_HUMANphysical interactionMINT-63343MINT16169070
B3A3_HUMANin vitroHPRD:02023HPRD11606574
SL9A1_HUMANin vitro
in vivo
HPRD:02023HPRD12138085
16475831
B3AT_HUMANin vitroHPRD:02023HPRD9774471
11063570
10820026
CH60_HUMANin vitroHPRD:02023HPRD9890926
10811634
ANKZ1_HUMANyeast 2-hybridHPRD:02023HPRD16169070
B3AT_HUMANENSP00000285379STRING
SL9A1_HUMANENSP00000285379STRING
THA_HUMANENSP00000285379STRING
PCY1A_HUMANENSP00000285379STRING
PCY1A_HUMANENSP00000285379STRING
B3A2_HUMANENSP00000285379STRING
CH60_HUMANENSP00000285379STRING
- top -

Disease Reference
Kegg disease
OMIM disease
259730Osteopetrosis, autosomal recessive 3 (OPTB3)
Drug Reference
DrugBank
DB00819Acetazolamide
DB00436Bendroflumethiazide
DB00562Benzthiazide
DB01194Brinzolamide
DB00880Chlorothiazide
DB00606Cyclothiazide
DB01119Diazoxide
DB01144Diclofenamide
DB00869Dorzolamide
DB01031Ethinamate
DB00695Furosemide
DB00999Hydrochlorothiazide
DB00774Hydroflumethiazide
DB00703Methazolamide
DB00232Methyclothiazide
DB01325Quinethazone
DB00273Topiramate
DB01021Trichlormethiazide
DB00909Zonisamide
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Primary structure of human carbonic anhydrase C.";
Henderson L.E., Henriksson D., Nyman P.O.;
J. Biol. Chem. 251:5457-5463(1976).
Cited for: PROTEIN SEQUENCE OF 2-260.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures