Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Carbonic anhydrase 4  

UniProtKB / Swiss-Prot ID :  CAH4_HUMAN

Gene Name (Synonyms) : 
CA4  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :  Reversible hydration of carbon dioxide. May stimulate the sodium/bicarbonate transporter activity of SLC4A4 that acts in pH homeostasis. It is essential for acid overload removal from the retina and retina epithelium, and acid release in the choriocapillaris in the choroid. 

Protein Sequence MRMLLALLALSAARPSASAESHWCYEVQAESSNYPCLVPVKWGGNCQKDRQSPINIVTTKAKVDKKLGRF...
Predicted Secondary Structure CHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEHHHEEECCCCCEE...
Protein Variant
LocationDescription
14R -> W (in RP17; abolishes interactionwith SLC4A4. Impaired SLC4A4
219R -> S (in RP17; no catalytic activity.Impaired SLC4A4 cotransporter activity
237V -> L (in dbSNP:rs2229178). VAR_048680
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
80PhosphothreonineDKKQTWTVQ
CCCCEEEEE
31.79Phosphositeplus
Link
82PhosphothreonineKQTWTVQNN
CCEEEEEEC
18.66Phosphositeplus
Link
89PhosphoserineNNGHSVMML
ECCEEEEEE
17.07Phosphositeplus
Link
196PhosphoserineKPEMSTTMA
CCCCEEECC
21.04HPRD
Link
198PhosphothreonineEMSTTMAES
CCEEECCCC
13.69HPRD
Link
198PhosphothreonineEMSTTMAES
CCEEECCCC
13.69Phosphositeplus
Link
284GPI-anchor amidated serineTVIKSGAPG
EEEECCCCC
29.12HPRD
Link-
284GPI-anchor amidated serine.TVIKSGAPG
EEEECCCCC
29.12UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
B3A3_HUMANin vitro
in vivo
HPRD:00261HPRD11994299
B3AT_HUMANin vitroHPRD:00261HPRD11994299
S4A4_HUMANin vitro
in vivo
HPRD:00261HPRD14567693
S4A4_HUMANENSP00000300900STRING
- top -

Disease Reference
Kegg disease
H00527 Retinitis pigmentosa (RP)
OMIM disease
600852Retinitis pigmentosa 17 (RP17)
Drug Reference
Kegg drug
D00218 Acetazolamide (JP16/USP/INN); Diamox (TN)
D00219 Acetohexamide (JP16/USP/INN); Dymelor (TN)
D00518 Diclofenamide (JP16/INN); Dichlorphenamide (USP); Daranide (TN)
D00652 Brinzolamide (JAN/USP/INN); Azopt (TN)
D00653 Dorzolamide hydrochloride (JP16/USP); Trusopt (TN)
D00655 Methazolamide (JAN/USP/INN); Neptazane (TN)
D01196 Acetazolamide sodium (JAN); Diamox (TN)
D01822 Clofenamide (JAN/INN)
D02441 Ethoxzolamide; Cardrase (TN)
D03845 Sezolamide hydrochloride (USAN)
D07871 Dorzolamide (INN); Trusopt (TN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Carbonic anhydrase IV: role of removal of C-terminal domain inglycosylphosphatidylinositol anchoring and realization of enzymeactivity.";
Okuyama T., Waheed A., Kusumoto W., Zhu X.L., Sly W.S.;
Arch. Biochem. Biophys. 320:315-322(1995).
Cited for: GPI-ANCHOR AT SER-284, AND MUTAGENESIS OF SER-284.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures