Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calbindin  

UniProtKB / Swiss-Prot ID :  CALB1_BOVIN

Gene Name (Synonyms) : 
CALB1  

Species :  Bos taurus (Bovine). 

Subcellular Localization :   

Protein Function :  Buffers cytosolic calcium. May stimulate a membrane Ca(2+)-ATPase and a 3',5'-cyclic nucleotide phosphodiesterase. 

Protein Sequence MAESHLQSSLITASQFFEIWLHFDADGSGYLEGKELQNLIQELQQARKKAGLELSPEMKTFVDQYGQRDD...
Predicted Secondary Structure CCCCCCCCCHHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHCCCCCHHHHCCHHHHHHHHHHHCCCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAESHL
---CCCCCC
27.31UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Amino acid sequence of vitamin D-dependent calcium-binding proteinfrom bovine cerebellum.";
Takagi T., Nojiri M., Konishi K., Maruyama K., Nonomura Y.;
FEBS Lett. 201:41-45(1986).
Cited for: PROTEIN SEQUENCE OF 2-261, AND ACETYLATION AT ALA-2.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures