Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calmodulin-like protein 5  

UniProtKB / Swiss-Prot ID :  CALL5_HUMAN

Gene Name (Synonyms) : 
CALML5, CLSP  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Binds calcium. May be involved in terminal differentiation of keratinocytes. 

Protein Sequence MAGELTPEEEAQYKKAFSAVDTDGNGTINAQELGAALKATGKNLSEAQLRKLISEVDSDGDGEISFQEFL...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCCCCHHHHH...
Protein Variant
LocationDescription
58S -> G (in dbSNP:rs11546426). VAR_047545
74K -> R (in dbSNP:rs10904516). VAR_047546
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAGELT
---CCCCCC
21.84UniProtKB
Link-
18PhosphoserineKKAFSAVDT
HHHHHHHCC
32.04HPRD
Link-
18PhosphoserineKKAFSAVDT
HHHHHHHCC
32.04Phosphositeplus
Link-
22PhosphothreonineSAVDTDGNG
HHHCCCCCC
38.93HPRD
Link-
22PhosphothreonineSAVDTDGNG
HHHCCCCCC
38.93Phosphositeplus
Link-
27PhosphothreonineDGNGTINAQ
CCCCCCCHH
18.30HPRD
Link-
27PhosphothreonineDGNGTINAQ
CCCCCCCHH
18.30Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
TGM3_HUMANin vitroHPRD:05538HPRD10777582
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures