Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calmodulin  

UniProtKB / Swiss-Prot ID :  CALM_BOVIN

Gene Name (Synonyms) : 
CALM, CAM  

Species :  Bos taurus (Bovine). 

Subcellular Localization :  Cytoplasm. Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole. Note=Distributed throughout the cell during interphase, but during mitosis becomes dramatically localized to the spindle poles and the spindle microtubules (By similarity 

Protein Function :  Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+). Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis (By similarity). 

Protein Sequence MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCEECHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADQLT
---CCCCCC
17.16UniProtKB
Link
14Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IAEFKEAFS
HHHHHHHHH
39.37UbiProtDB
Link
22Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLFDKDGDG
HHHCCCCCC
57.17UbiProtDB
Link
22Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin).SLFDKDGDG
HHHCCCCCC
57.17UniProtKB
Link
95Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RVFDKDGNG
HHHCCCCCC
56.95UbiProtDB
Link
116N6,N6,N6-trimethyllysineNLGEKLTDE
HHCCCCCHH
55.69Phosphositeplus
Link
116N6,N6,N6-trimethyllysine.NLGEKLTDE
HHCCCCCHH
55.69UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"The complete amino acid sequence of the Ca2+-dependent modulatorprotein (calmodulin) of bovine brain.";
Watterson D.M., Sharief F., Vanaman T.C.;
J. Biol. Chem. 255:962-975(1980).
Cited for: PROTEIN SEQUENCE OF 2-149, ACETYLATION AT ALA-2, AND METHYLATION ATLYS-116.
Methylation
ReferencePubMed
"The complete amino acid sequence of the Ca2+-dependent modulatorprotein (calmodulin) of bovine brain.";
Watterson D.M., Sharief F., Vanaman T.C.;
J. Biol. Chem. 255:962-975(1980).
Cited for: PROTEIN SEQUENCE OF 2-149, ACETYLATION AT ALA-2, AND METHYLATION ATLYS-116.
Ubiquitylation
ReferencePubMed
"Modulation of calmodulin function by ubiquitin-calmodulin ligase andidentification of the responsible ubiquitylation site in vertebratecalmodulin.";
Laub M., Steppuhn J.A., Blueggel M., Immler D., Meyer H.E.,Jennissen H.P.;
Eur. J. Biochem. 255:422-431(1998).
Cited for: PROTEIN SEQUENCE OF 2-28, AND UBIQUITINATION AT LYS-22.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures