Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calmodulin  

UniProtKB / Swiss-Prot ID :  CALM_RAT

Gene Name (Synonyms) : 
Calm1, Calm, Cam, Cam1
Calm2, Cam2, Camb
Calm3, Cam3, Camc  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Cytoplasm, cytoskeleton, spindle. Cytoplasm, cytoskeleton, spindle pole. Note=Distributed throughout the cell during interphase, but during mitosis becomes dramatically localized to the spindle poles and the spindle microtubules (By similarity). 

Protein Function :  Calmodulin mediates the control of a large number of enzymes, ion channels and other proteins by Ca(2+), AND MASS SPECTROMETRY. Among the enzymes to be stimulated by the calmodulin-Ca(2+) complex are a number of protein kinases and phosphatases. Together with CEP110 and centrin, is involved in a genetic pathway that regulates the centrosome cycle and progression through cytokinesis (By similarity). 

Protein Sequence MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHCCCCCCEECHHHHHHHHHHHCCCCCHHHHHHHHHHHCCCCCCEECHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MADQLT
---CCCCCC
17.16UniProtKB
Link
45PhosphothreonineGQNPTEAEL
CCCCCHHHH
56.21Phosphositeplus
Link
45Phosphothreonine; by CaMK4.GQNPTEAEL
CCCCCHHHH
56.21UniProtKB
Link
80PhosphothreonineKMKDTDSEE
HCCCCCCHH
35.59Phosphositeplus
Link
80Phosphothreonine (CK2_group)KMKDTDSEE
HCCCCCCHH
35.59PhosphoELM
Link
82PhosphoserineKDTDSEEEI
CCCCCHHHH
49.34Phosphositeplus
Link
82Phosphoserine (CK2_group)KDTDSEEEI
CCCCCHHHH
49.34PhosphoELM
Link
100PhosphotyrosineDGNGYISAA
CCCCCCCHH
8.83PhosphoELM
Link
100PhosphotyrosineDGNGYISAA
CCCCCCCHH
8.83Phosphositeplus
Link
102PhosphoserineNGYISAAEL
CCCCCHHHH
16.97Phosphositeplus
Link
102Phosphoserine (CK2_group)NGYISAAEL
CCCCCHHHH
16.97PhosphoELM
Link
116N6,N6,N6-trimethyllysineNLGEKLTDE
HHCCCCCHH
55.69Phosphositeplus
Link
116N6,N6,N6-trimethyllysine.NLGEKLTDE
HHCCCCCHH
55.69UniProtKB
Link
118PhosphothreonineGEKLTDEEV
CCCCCHHHH
53.05Phosphositeplus
Link
139PhosphotyrosineGQVNYEEFV
CEECHHHHH
20.27PhosphoELM
Link
139PhosphotyrosineGQVNYEEFV
CEECHHHHH
20.27Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Sequence homology of the Ca2+-dependent regulator of cyclicnucleotide phosphodiesterase from rat testis with other Ca2+-bindingproteins.";
Dedman J.R., Jackson R.L., Schreiber W.E., Means A.R.;
J. Biol. Chem. 253:343-346(1978).
Cited for: PROTEIN SEQUENCE OF 2-149, ACETYLATION AT ALA-2, AND METHYLATION ATLYS-116.
Methylation
ReferencePubMed
"Sequence homology of the Ca2+-dependent regulator of cyclicnucleotide phosphodiesterase from rat testis with other Ca2+-bindingproteins.";
Dedman J.R., Jackson R.L., Schreiber W.E., Means A.R.;
J. Biol. Chem. 253:343-346(1978).
Cited for: PROTEIN SEQUENCE OF 2-149, ACETYLATION AT ALA-2, AND METHYLATION ATLYS-116.
Phosphorylation
ReferencePubMed
"Phosphorylation of calmodulin by Ca2+/calmodulin-dependent proteinkinase IV.";
Ishida A., Kameshita I., Okuno S., Kitani T., Fujisawa H.;
Arch. Biochem. Biophys. 407:72-82(2002).
Cited for: PHOSPHORYLATION AT THR-45.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures