Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calpain-2 catalytic subunit  

UniProtKB / Swiss-Prot ID :  CAN2_HUMAN

Gene Name (Synonyms) : 
CAPN2, CANPL2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cytoplasm. Cell membrane. Note=Translocates to the plasma membrane upon Ca(2+) binding. 

Protein Function :  Calcium-regulated non-lysosomal thiol-protease which catalyze limited proteolysis of substrates involved in cytoskeletal remodeling and signal transduction. 

Protein Sequence MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGFKELGPYSSKT...
Predicted Secondary Structure CCHHHHHHHHHHHHHHCCCHHHHHHHCCCCCHHHHHHHHHHCCCEEECCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
22D -> E (in dbSNP:rs25655). VAR_014435
68S -> G (in dbSNP:rs2230083). VAR_021404
476K -> R (in dbSNP:rs9804140). VAR_021405
521E -> Q (in dbSNP:rs28370127). VAR_021406
568K -> Q (in dbSNP:rs17599). VAR_014436
677K -> Q (in dbSNP:rs2230082). VAR_021407
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
7N6-acetyllysineGIAAKLAKD
HHHHHHHHH
39.70HPRD
Link
7N6-acetyllysineGIAAKLAKD
HHHHHHHHH
39.70Phosphositeplus
Link
26Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)DRAIKYLNQ
HHHHHCCCC
42.58Phosphositeplus
Link
50PhosphoserineFQDPSFPAI
EECCCCCCC
52.75Phosphositeplus
Link
50Phosphoserine (MAPK3;MAPK1)FQDPSFPAI
EECCCCCCC
52.75PhosphoELM
Link
69Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)PYSSKTRGI
CCCCCCCCC
35.98Phosphositeplus
Link
260Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)QKLVKGHAY
CCCCCCCCE
56.25Phosphositeplus
Link
280Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSLQKLIRI
CCEEEEEEE
51.69Phosphositeplus
Link
360Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)WKLTKMDGN
EEEEEECCC
45.49Phosphositeplus
Link
369PhosphoserineWRRGSTAGG
CCCCCCCCC
17.17Phosphositeplus
Link
369Phosphoserine (PKA_group)WRRGSTAGG
CCCCCCCCC
17.17PhosphoELM
Link
370PhosphothreonineRRGSTAGGC
CCCCCCCCC
31.95Phosphositeplus
Link
370Phosphothreonine (PKA_group)RRGSTAGGC
CCCCCCCCC
31.95PhosphoELM
Link
390Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in SUMO)QYLIKLEEE
EEEEEECCC
47.45Phosphositeplus
Link
476Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)LNRFKLPPG
CEEEEECCC
57.77Phosphositeplus
Link
674Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)ETLFKIFKQ
HHHHHHHHH
50.80Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
NMT1_HUMANphysical interactionMINT-1795337MINT16530191
ARBK1_HUMANin vitro
in vivo
HPRD:00254HPRD12130691
CD5R1_HUMANin vitro
in vivo
HPRD:00254HPRD10830966
CPNS1_HUMANin vitroHPRD:00254HPRD10666632
10639123
11673052
11517928
PAR2_HUMANin vitroHPRD:00254HPRD10978167
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures