Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cullin-associated NEDD8-dissociated protein 1  

UniProtKB / Swiss-Prot ID :  CAND1_ARATH

Gene Name (Synonyms) : 
CAND1, ETA2, HVE At2g02560T8K22.14  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :   

Protein Function :  Required for SCF(TIR1) function. Modulates SCF(TIR1) function through its interactions with the CUL1 subunit. Positively regulates multiple E3 ubiquitin-protein ligase complexes and their associated developmental processes. Represses photomorphogenesis by promoting HY5 degradation in darkness. 

Protein Sequence MANLQVSGILEKFQMTGKDKDYRYMATSDLLNELNKDSFKIDLDLEVRLSSIILQQLDDVAGDVSGLAVK...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures