Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Vacuolar cation/proton exchanger 1  

UniProtKB / Swiss-Prot ID :  CAX1_ARATH

Gene Name (Synonyms) : 
CAX1, RCI4 At2g38170F16M14.10  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :  Vacuole membrane; Multi-pass membrane protein (Probable). Note=Tonoplast. 

Protein Function :  Vacuolar cation/proton exchanger (CAX). Translocates Ca(2+) and other metal ions into vacuoles using the proton gradient formed by H(+)-ATPase and H(+)-pyrophosphatase. Involved in ion homeostasis in association with CAX3. May play a role in cold-acclimation response. 

Transmembrane Topology (topPTM) : CAX1_ARATH 

Protein Sequence MAGIVTEPWSVAENGNPSITAKGSSRELRLGRTAHNMSSSSLRKKSDLRVIQKVPYKGLKDFLSNLQEVI...
Predicted Secondary Structure CCCCCCCCHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures