Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Coiled-coil domain-containing protein 6  

UniProtKB / Swiss-Prot ID :  CCDC6_MOUSE

Gene Name (Synonyms) : 
Ccdc6  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm (By similarity). Cytoplasm, cytoskeleton (By similarity). Note=May be a cytoskeletal protein (By similarity). 

Protein Function :   

Protein Sequence MADSASESDTDAAGGGPAAMQSSCSATSGGSGGGGGGKSGGIVISPFRLEELTNRLASLQQENKVLKIEL...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
45PhosphoserineGIVISPFRL
13.69Phosphositeplus
Link-
233PhosphoserineDQPVSAPPS
41.56Phosphositeplus
Link-
237PhosphoserineSAPPSPRDI
31.35Phosphositeplus
Link-
247PhosphoserineMEIDSPENM
39.51Phosphositeplus
Link-
316PhosphoserineCRQLSESES
30.64Phosphositeplus
Link-
318PhosphoserineQLSESESSL
39.13Phosphositeplus
Link-
320PhosphoserineSESESSLEM
49.88Phosphositeplus
Link-
321PhosphoserineESESSLEMD
25.05Phosphositeplus
Link-
342PhosphothreonineLRPRTVSSP
27.67Phosphositeplus
Link-
344PhosphoserinePRTVSSPIP
29.77Phosphositeplus
Link-
345PhosphoserineRTVSSPIPY
23.63Phosphositeplus
Link-
349PhosphotyrosineSPIPYTPSP
31.81Phosphositeplus
Link-
350PhosphothreoninePIPYTPSPS
16.37Phosphositeplus
Link-
352PhosphoserinePYTPSPSSS
29.61Phosphositeplus
Link-
354PhosphoserineTPSPSSSRP
45.33Phosphositeplus
Link-
356PhosphoserineSPSSSRPIS
46.55Phosphositeplus
Link-
360PhosphoserineSRPISPGLS
18.65Phosphositeplus
Link-
373PhosphothreonineTVGFTPPTS
23.56Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures