Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  C-C motif chemokine 5  

UniProtKB / Swiss-Prot ID :  CCL5_HUMAN

Gene Name (Synonyms) : 
CCL5, D17S136E, SCYA5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. 

Protein Function :  Chemoattractant for blood monocytes, memory T-helper cells and eosinophils. Causes the release of histamine from basophils and activates eosinophils. Binds to CCR1, CCR3, CCR4 and CCR5. One of the major HIV-suppressive factors produced by CD8+ T- cells. Recombinant RANTES protein induces a dose-dependent inhibition of different strains of HIV-1, HIV-2, and simian immunodeficiency virus (SIV). The processed form RANTES(3-68) acts as a natural chemotaxis inhibitor and is a more potent inhibitor of HIV-1-infection. The second processed form RANTES(4-68) exhibits reduced chemotactic and HIV-suppressive activity compared with RANTES(1-68) and RANTES(3-68) and is generated by an unidentified enzyme associated with monocytes and neutrophils. 

Protein Sequence MKVSAAALAVILIATALCAPASASPYSSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNR...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHCCCCCCCHHHEEEEEECCCCCCCCCEEEEECCCC...
Protein Variant
LocationDescription
24S -> F. VAR_043043
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
25noneASASPYSSD
CCCCCCCCC
32.51HPRD
Link
27O-linked (GalNAc...)ASPYSSDTT
CCCCCCCCC
25.73HPRD
Link
27O-linked (GalNAc...); partial.ASPYSSDTT
CCCCCCCCC
25.73UniProtKB
Link
28O-linked (GalNAc...)SPYSSDTTP
CCCCCCCCC
32.88HPRD
Link
28O-linked (GalNAc...); partial.SPYSSDTTP
CCCCCCCCC
32.88UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
CCR1_HUMANphysical interactionMINT-16964MINT7545673
CCR3_HUMANphysical interactionMINT-17569MINT10488147
CCR5_HUMANphysical interactionMINT-16397MINT10477718
CCR1_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
DIP:10360EDIP9115216
8530354
7545673
7622448
9336350
10910894
CCR3_HUMANphysical interaction
physical interaction
DIP:10380EDIP7622448
10733106
CCR5_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
DIP:10461EDIP10477718
9334377
9207005
10488147
DUFFY_HUMANin vitro
in vivo
HPRD:01751HPRD12081195
GRB2_HUMANin vivoHPRD:01751HPRD9009162
CSPG2_HUMANin vitroHPRD:01751HPRD11083865
PIGR_HUMANin vivoHPRD:01751HPRD11509627
SDC1_HUMANin vivoHPRD:01751HPRD14637022
CCL5_HUMANin vitroHPRD:01751HPRD7542919
8576227
9889151
CFTR_HUMANENSP00000293272STRING
CD4_HUMANENSP00000293272STRING
IFNG_HUMANENSP00000293272STRING
CXCR4_HUMANENSP00000293272STRING
IRF1_HUMANENSP00000293272STRING
SLUR1_HUMANENSP00000293272STRING
SLUR1_HUMANENSP00000293272STRING
SDC1_HUMANENSP00000293272STRING
CD8A_HUMANENSP00000293272STRING
ITAM_HUMANENSP00000293272STRING
CXCR5_HUMANENSP00000293272STRING
CCR2_HUMANENSP00000293272STRING
CCR5_HUMANENSP00000293272STRING
REL_HUMANENSP00000293272STRING
PLF4_HUMANENSP00000293272STRING
CCR1_HUMANENSP00000293272STRING
KLF13_HUMANENSP00000293272STRING
ITB2_HUMANENSP00000293272STRING
CXL10_HUMANENSP00000293272STRING
IRF3_HUMANENSP00000293272STRING
CD28_HUMANENSP00000293272STRING
CCR4_HUMANENSP00000293272STRING
TNR6_HUMANENSP00000293272STRING
CCR3_HUMANENSP00000293272STRING
DPP4_HUMANENSP00000293272STRING
- top -

Disease Reference
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
O-linked Glycosylation
ReferencePubMed
"Cytokine RANTES released by thrombin-stimulated platelets is a potentattractant for human eosinophils.";
Kameyoshi Y., Doerschner A., Mallet A.I., Christophers E.,Schroeder J.-M.;
J. Exp. Med. 176:587-592(1992).
Cited for: PROTEIN SEQUENCE OF 24-55, FUNCTION, MASS SPECTROMETRY, GLYCOSYLATIONAT SER-27 AND SER-28, AND OXIDATION AT MET-90.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures