Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  CAMPATH-1 antigen  

UniProtKB / Swiss-Prot ID :  CD52_HUMAN

Gene Name (Synonyms) : 
CD52, CDW52, HE5  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :  May play a role in carrying and orienting carbohydrate, as well as having a more specific role. 

Protein Sequence MKRFLFLLLTISLLVMVQIQTGLSGQNDTSQTSSPSASSNISGGIFLFFVANAIIHLFCFS...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC...
Protein Variant
LocationDescription
40NI -> SM. VAR_005130
40N -> S (in dbSNP:rs1071849). VAR_050775
41I -> M (in dbSNP:rs17645). VAR_014838
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
27N-linked (Glc...)LSGQNDTSQ
CCCCCCCCC
59.04HPRD
Link-
27N-linked (GlcNAc...).LSGQNDTSQ
CCCCCCCCC
59.04UniProtKB
Link-
36GPI-anchor amidated serineTSSPSASSN
CCCCCCCCC
42.61HPRD
Link-
36GPI-anchor amidated serine.TSSPSASSN
CCCCCCCCC
42.61UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D02802 Alemtuzumab (genetical recombination) (JAN); Alemtuzumab (USAN/INN); Campath (TN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
GPI-anchor
ReferencePubMed
"Structure of the CAMPATH-1 antigen, a glycosylphosphatidylinositol-anchored glycoprotein which is an exceptionally good target forcomplement lysis.";
Xia M.Q., Hale G., Lifely M.R., Ferguson M.A., Campbell D.,Packman L., Waldmann H.;
Biochem. J. 293:633-640(1993).
Cited for: GPI-ANCHOR AT SER-36.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures