Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Codanin-1  

UniProtKB / Swiss-Prot ID :  CDAN1_HUMAN

Gene Name (Synonyms) : 
CDAN1 UNQ664/PRO1295  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :  Might be involved in nuclear membrane integrity. 

Transmembrane Topology (topPTM) : CDAN1_HUMAN 

Protein Sequence MAAVLESLLREEVSVAAVVRWIARSTQGSEDNAGEAAALSSLRALRKEFVPFLLNFLREQSSRVLPQGPP...
Predicted Secondary Structure CHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHCCCCCCC...
Protein Variant
LocationDescription
107Q -> L (in dbSNP:rs4265781). VAR_059602
596Q -> R (in dbSNP:rs12917189). VAR_056785
599N -> S (in CDA1). VAR_017218
672P -> L (in CDA1). VAR_017219
698E -> K (in CDA1). VAR_017220
714R -> W (in CDA1). VAR_017221
868F -> I (in CDA1). VAR_017222
869V -> M (in CDA1). VAR_017223
891R -> C (in dbSNP:rs8023524). VAR_056786
1042R -> W (in CDA1). VAR_017224
1043D -> V (in CDA1). VAR_017225
1130P -> L (in CDA1). VAR_017226
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
71PhosphothreonineQGPPTPAKT
CCCCCCCCC
38.73Phosphositeplus
Link-
71Phosphothreonine.QGPPTPAKT
CCCCCCCCC
38.73UniProtKB
Link-
158PhosphoserineRGSGSPSRP
CCCCCCCCC
22.77Phosphositeplus
Link-
265PhosphoserineQLQQSPTPT
CCCCCCCCC
20.13HPRD
Link-
265Phosphoserine.QLQQSPTPT
CCCCCCCCC
20.13UniProtKB
Link-
272PhosphothreoninePTCPTPELG
CCCCCCCCC
31.38Phosphositeplus
Link-
277PhosphoserinePELGSPLPS
CCCCCCCCC
35.57HPRD
Link-
277PhosphoserinePELGSPLPS
CCCCCCCCC
35.57Phosphositeplus
Link-
277Phosphoserine.PELGSPLPS
CCCCCCCCC
35.57UniProtKB
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
PCNA_HUMANphysical interaction
physical interaction
physical interaction
physical interaction
physical interaction
physical interaction
DIP:40112EDIP11682605
11682605
8861913
9305916
10930425
11682605
GA45A_HUMANphysical interactionDIP:40129EDIP10973963
HFE_HUMANENSP00000348564STRING
- top -

Disease Reference
Kegg disease
H00917 Congenital dyserythropoietic anemias (CDAs)
OMIM disease
224120Anemia, congenital dyserythropoietic, 1A (CDAN1A)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-71; SER-265 AND SER-277,AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures