Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Carcinoembryonic antigen-related cell adhesion molecule 7  

UniProtKB / Swiss-Prot ID :  CEAM7_HUMAN

Gene Name (Synonyms) : 
CEACAM7, CGM2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor (Potential). 

Protein Function :   

Protein Sequence MGSPSACPYRVCIPWQGLLLTASLLTFWNLPNSAQTNIDVVPFNVAEGKEVLLVVHNESQNLYGYNWYKG...
Predicted Secondary Structure CCCCCCCCCCCCCCCEEEEEEEEEHHEECCCCCCEEEEEECCCCCCCCCCEEEEEECCCCCCCEEEEECC...
Protein Variant
LocationDescription
120F -> I (in dbSNP:rs8102488). VAR_024494
236Y -> H (in dbSNP:rs16975478). VAR_059384
263A -> V (in dbSNP:rs7259532). VAR_049848
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
236PhosphotyrosineLNVRYESVQ
EEEEECCCE
14.31Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
Kegg drug
D02977 Arcitumomab (USAN/INN); Cea-Scan (TN)
D06028 Technetium Tc 99m arcitumomab (USP)
D06350 Yttrium Y 90 labetuzumab (USAN); CES-Cide (TN)
D06351 Yttrium Y 90 labetuzumab tetraxetan (USAN)
D08936 Labetuzumab (INN/USAN)
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures