Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Centromere protein T  

UniProtKB / Swiss-Prot ID :  CENPT_RAT

Gene Name (Synonyms) : 
Cenpt  

Species :  Rattus norvegicus (Rat). 

Subcellular Localization :  Nucleus (By similarity). Chromosome, centromere (By similarity). Chromosome, centromere, kinetochore (By similarity). Note=Constitutively localizes to centromeres throughout the cell cycle, and to kinetochores during mitosis (By similarity). 

Protein Function :  Component of the CENPA-NAC (nucleosome-associated) complex, a complex that plays a central role in assembly of kinetochore proteins, mitotic progression and chromosome segregation. The CENPA-NAC complex recruits the CENPA-CAD (nucleosome distal) complex and may be involved in incorporation of newly synthesized CENPA into centromeres. Part of a nucleosome- associated complex that binds specifically to histone H3- containing nucleosomes at the centromere, as opposed to nucleosomes containing CENPA. Component of the heterotetrameric CENP-T-W-S-X complex that binds and supercoils DNA, and plays an important role in kinetochore assembly. CENPT has a fundamental role in kinetochore assembly and function. It is one of the inner kinetochore proteins, with most further proteins binding downstream. Required for normal chromosome organization and normal progress through mitosis (By similarity). 

Protein Sequence MADLSSPDGDPTIRTLLRHVLDTADSHTPRRRQSTQTNPQRRRSQTPYSKRQGSQRKTSTRKHSHGTGSV...
Predicted Secondary Structure CCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCHHHHCCHHHHHHHCCHHHHHCCCHHHHHHHHCCCCHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures