Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ceramide synthase 1  

UniProtKB / Swiss-Prot ID :  CERS1_HUMAN

Gene Name (Synonyms) : 
CERS1, LAG1, LASS1, UOG1  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Endoplasmic reticulum membrane; Multi-pass membrane protein (By similarity). Isoform 1: Endoplasmic reticulum membrane; Multi-pass membrane protein (By similarity). Golgi apparatus membrane; Multi-pass membrane protein (By similarity). Note=Isoform 1 may 

Protein Function :  May be either a bona fide (dihydro)ceramide synthase or a modulator of its activity. When overexpressed in cells is involved in the production of sphingolipids containing mainly one fatty acid donor (N-linked stearoyl- (C18) ceramide) in a fumonisin B1-independent manner (By similarity). 

Transmembrane Topology (topPTM) : CERS1_HUMAN 

Protein Sequence MAAAGPAAGPTGPEPMPSYAQLVQRGWGSALAAARGCTDCGWGLARRGLAEHAHLAPPELLLLALGALGW...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
301PhosphotyrosineYWFLYIVAF
5.49Phosphositeplus
Link-
318Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)VHELKDLRE
52.29Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
OMIM disease
616230Epilepsy, progressive myoclonic 8 (EPM8)
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures