Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  O-acetyl-ADP-ribose deacetylase C6orf130 homolog  

UniProtKB / Swiss-Prot ID :  CF130_MOUSE

Gene Name (Synonyms) :  -
 

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  Deacetylates O-acetyl-ADP ribose, a signaling molecule generated by the deacetylation of acetylated lysine residues in histones and other proteins. Catalyzes the deacylation of O- acetyl-ADP-ribose, O-propionyl-ADP-ribose and O-butyryl-ADP- ribose, yielding ADP-ribose plus acetate, propionate and butyrate, respectively (By similarity). 

Protein Sequence MASRLNEDPEGSRITYVKGDLFACPKTDSLAHCISEDCRMGAGIAVLFKKRFGGVQELLSQQKKSGEVAV...
Predicted Secondary Structure CCCCCCCCCCCCEEEEEECCEEECCCCCHHHHHHHHHCCCCCCHHHHHHHHCCHHHHHHHHHHCCCCEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures