Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cystic fibrosis transmembrane conductance regulator  

UniProtKB / Swiss-Prot ID :  CFTR_MOUSE

Gene Name (Synonyms) : 
Cftr, Abcc7  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Early endosome membrane; Multi-pass membrane protein (By similarity). 

Protein Function :  Involved in the transport of chloride ions. May regulate bicarbonate secretion and salvage in epithelial cells by regulating the SLC4A7 transporter. 

Transmembrane Topology (topPTM) : CFTR_MOUSE 

Protein Sequence MQKSPLEKASFISKLFFSWTTPILRKGYRHHLELSDIYQAPSADSADHLSEKLEREWDREQASKKNPQLI...
Predicted Secondary Structure CCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
422PhosphoserineDRKHSSDEN
CCCCEEEEE
42.38Phosphositeplus
Link-
659PhosphoserineEERRSSILT
HHHHHHHHH
28.14Phosphositeplus
Link
660PhosphoserineERRSSILTE
HHHHHHHHH
21.58Phosphositeplus
Link
670PhosphoserineLRRFSVDDS
HHHCCCCCC
23.87Phosphositeplus
Link-
698PhosphoserineKRKNSILNS
HHHHHHHHH
31.33Phosphositeplus
Link-
763PhosphoserineRRRQSVLDL
CHHHHHHHH
23.88Phosphositeplus
Link-
790PhosphoserineIRKISLVPQ
HHHHHHHHH
26.75Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures