Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Choline/ethanolamine kinase  

UniProtKB / Swiss-Prot ID :  CHKB_HUMAN

Gene Name (Synonyms) : 
CHKB, CHETK, CHKL  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis. 

Protein Sequence MAAEATAVAGSGAVGGCLAKDGLQQSKCPDTTPKRRRASSLSRDAERRAYQWCREYLGGAWRRVQPEELR...
Predicted Secondary Structure CCCCCCEEECCCCCCCCCCHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCHHHEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAAEAT
---CCCCCC
17.63UniProtKB
Link-
39PhosphoserineRRRASSLSR
CCCCCCCCC
29.96HPRD
Link
39PhosphoserineRRRASSLSR
CCCCCCCCC
29.96Phosphositeplus
Link
39Phosphoserine.RRRASSLSR
CCCCCCCCC
29.96UniProtKB
Link
40PhosphoserineRRASSLSRD
CCCCCCCCH
29.40Phosphositeplus
Link
42PhosphoserineASSLSRDAE
CCCCCCHHH
30.02HPRD
Link
42Phosphoserine.ASSLSRDAE
CCCCCCHHH
30.02UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
DrugBank
DB00122Choline
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Improved titanium dioxide enrichment of phosphopeptides from HeLacells and high confident phosphopeptide identification by cross-validation of MS/MS and MS/MS/MS spectra.";
Yu L.-R., Zhu Z., Chan K.C., Issaq H.J., Dimitrov D.S., Veenstra T.D.;
J. Proteome Res. 6:4150-4162(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-39 AND SER-42, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures