Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Choline/ethanolamine kinase  

UniProtKB / Swiss-Prot ID :  CHKB_MOUSE

Gene Name (Synonyms) : 
Chkb, Chetk, Chkl  

Species :  Mus musculus (Mouse). 

Subcellular Localization :   

Protein Function :  Has a key role in phospholipid biosynthesis. Catalyzes the first step in phosphatidylethanolamine biosynthesis. Phosphorylates ethanolamine, and can also act on choline (in vitro). Has higher activity with ethanolamine. May not significantly contribute to in vivo phosphatidylcholine biosynthesis (By similarity). 

Protein Sequence MAADGTGVVGGGAVGGGLPKDGLQDAKCPEPIPNRRRASSLSRDAQRRAYQWCREYLGGAWRRARPEELS...
Predicted Secondary Structure CCCCCCEEECCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCHHHHCCCHHHEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
72S-nitrosocysteineELSVCPVSG
HEEEEEEEC
2.18dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures