Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Chromatin target of PRMT1 protein  

UniProtKB / Swiss-Prot ID :  CHTOP_HUMAN

Gene Name (Synonyms) : 
CHTOP, C1orf77, FOP HT031, PP7704  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Nucleus. Nucleus, nucleolus. Note=Associated with facultative heterochromatin. 

Protein Function :  Plays an important role in the ligand-dependent activation of estrogen receptor target genes. May play a role in the silencing of fetal globin genes. 

Protein Sequence MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
33PhosphothreonineNKQPTPVNI
37.06HPRD
Link-
33PhosphothreonineNKQPTPVNI
37.06Phosphositeplus
Link-
33Phosphothreonine.NKQPTPVNI
37.06UniProtKB
Link-
40PhosphoserineNIRASMQQQ
13.79HPRD
Link-
40PhosphoserineNIRASMQQQ
13.79Phosphositeplus
Link-
40Phosphoserine.NIRASMQQQ
13.79UniProtKB
Link-
226Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AYMSKTKGH
37.41Phosphositeplus
Link-
227PhosphothreonineYMSKTKGHL
34.64HPRD
Link-
228Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)MSKTKGHLD
48.33Phosphositeplus
Link-
242PhosphothreonineYMAQTDPET
43.94HPRD
Link-
242PhosphothreonineYMAQTDPET
43.94PhosphoELM
Link-
242PhosphothreonineYMAQTDPET
43.94Phosphositeplus
Link-
242PhosphothreonineYMAQTDPET
43.94SysPTM
Link-
242Phosphothreonine.YMAQTDPET
43.94UniProtKB
Link-
246PhosphothreonineTDPETND
50.50HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Global, in vivo, and site-specific phosphorylation dynamics insignaling networks.";
Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P.,Mann M.;
Cell 127:635-648(2006).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-242, AND MASSSPECTROMETRY.
"Evaluation of the low-specificity protease elastase for large-scalephosphoproteome analysis.";
Wang B., Malik R., Nigg E.A., Korner R.;
Anal. Chem. 80:9526-9533(2008).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT THR-33 AND SER-40, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures