Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Lantibiotic cinnamycin  

UniProtKB / Swiss-Prot ID :  CINA_STRGV

Gene Name (Synonyms) : 
cinA, rocA  

Species :  Streptoverticillium griseoverticillatum. 

Subcellular Localization :   

Protein Function :  Can act as inhibitor of the enzyme phospholipase A2, and of the angiotensin-converting enzyme. Shows inhibitory activities against herpes simplex virus and immunopotentiating activities. Its antimicrobial activities are not very pronounced. 

Protein Sequence MTASILQQSVVDADFRAALLENPAAFGASAAALPTPVEAQDQASLDFWTKDIAATEAFACRQSCSFGPFT...
Predicted Secondary Structure CCHHHHHHHHHCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCCCCEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
60Beta-methyllanthionine (Cys-Thr).EAFACRQSC
HHHHHHCCC
3.08UniProtKB
Link
63Lanthionine (Ser-Cys).ACRQSCSFG
HHHCCCCCC
7.74UniProtKB
Link
64Beta-methyllanthionine (Cys-Thr).CRQSCSFGP
HHCCCCCCC
2.71UniProtKB
Link
65Lysinoalanine (Ser-Lys).RQSCSFGPF
HCCCCCCCE
38.19UniProtKB
Link
74(3R)-3-hydroxyaspartate.TFVCDGNTK
EEEECCCCC
48.34UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures