Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cyclin-dependent kinases regulatory subunit 2  

UniProtKB / Swiss-Prot ID :  CKS2_HUMAN

Gene Name (Synonyms) : 
CKS2  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. 

Protein Sequence MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR...
Predicted Secondary Structure CCCCCCCCCCCCCCCCCCEEEEECCHHHHHHCCCCCCCCHHHHHHCCCCCCCCEEEEEEECCCCCEEEEE...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
4N6-acetyllysine-MAHKQIYY
-CCCCCCCC
28.93HPRD
Link
4N6-acetyllysine-MAHKQIYY
-CCCCCCCC
28.93Phosphositeplus
Link
4N6-acetyllysine.-MAHKQIYY
-CCCCCCCC
28.93UniProtKB
Link
7PhosphotyrosineHKQIYYSDK
CCCCCCCCC
8.40HPRD
Link
7PhosphotyrosineHKQIYYSDK
CCCCCCCCC
8.40Phosphositeplus
Link
11Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)YYSDKYFDE
CCCCCCCCC
41.71Phosphositeplus
Link
51PhosphoserineGVQQSLGWV
CCCCCCCEE
16.26PhosphoELM
Link
51PhosphoserineGVQQSLGWV
CCCCCCCEE
16.26Phosphositeplus
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
Q5JR01_HUMANphysical interactionMINT-63685MINT16169070
EF1A1_HUMANphysical interactionEBI-728838
intact16169070
UN119_HUMANphysical interactionEBI-728841
intact16169070
T22D4_HUMANphysical interactionEBI-757702
intact16189514
CKS1_HUMANin vitroHPRD:00300HPRD2227411
EF1A1_HUMANyeast 2-hybridHPRD:00300HPRD16169070
UN119_HUMANyeast 2-hybridHPRD:00300HPRD16169070
T22D4_HUMANyeast 2-hybridHPRD:00300HPRD16189514
CKS2_HUMANin vitroHPRD:00300HPRD8211159
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-4, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures