Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cytokinin dehydrogenase 7  

UniProtKB / Swiss-Prot ID :  CKX7_ARATH

Gene Name (Synonyms) : 
CKX7, CKX5 At5g21482F13M11.?  

Species :  Arabidopsis thaliana (Mouse-ear cress). 

Subcellular Localization :   

Protein Function :  Catalyzes the oxidation of cytokinins, a family of N(6)- substituted adenine derivatives that are plant hormones, where the substituent is an isopentenyl group (By similarity). 

Protein Sequence MIAYIEPYFLENDAEAASAATAAGKSTDGVSESLNIQGEILCGGAAADIAGRDFGGMNCVKPLAVVRPVG...
Predicted Secondary Structure CCCCCCHHHHHHHHHHHHHHHHCCCCHHHHHHHHHCCCCEEECCCHHHHHHHCCCCEEECCCCEEECCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
96Pros-8alpha-FAD histidine.RGNGHSING
ECCCCCCCC
29.51UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures