Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Choline O-acetyltransferase  

UniProtKB / Swiss-Prot ID :  CLAT_HUMAN

Gene Name (Synonyms) : 
CHAT  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :  Catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses. 

Protein Sequence MGLRTAKKRGLGGGGKWKREEGGGTRGRREVRPACFLQSGGRGDPGDVGGPAGNPGCSPHPRAATRPPPL...
Predicted Secondary Structure CCCCCCHHCCCCCCCCCCCCCCCCCCCCHHCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC...
Protein Variant
LocationDescription
47D -> E (in dbSNP:rs3810948). VAR_046683
120A -> T (in dbSNP:rs3810950). VAR_011675
210L -> P (in CMSEA; impaired activity;dbSNP:rs28930071).
211P -> A (in CMSEA; impaired activity). VAR_011667
222R -> P (in dbSNP:rs8178989). VAR_046684
243L -> F (in dbSNP:rs8178990). VAR_046685
299P -> L (in dbSNP:rs868749). VAR_046686
305I -> T (in CMSEA; impaired activity;dbSNP:rs28929482).
336I -> T (in CMSEA). VAR_038605
392A -> G. VAR_011676
400D -> N (in dbSNP:rs8178991). VAR_046687
420R -> C (in CMSEA; impaired activity). VAR_011669
441E -> K (in CMSEA; completely lackactivity; dbSNP:rs28930070).
461V -> M (in dbSNP:rs4838544). VAR_046688
482R -> G (in CMSEA; impaired activity;dbSNP:rs28929481).
498S -> L (in CMSEA; impaired activity). VAR_011672
506V -> L (in CMSEA; impaired activity). VAR_011673
560R -> H (in CMSEA; impaired activity). VAR_011674
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
373Phosphothreonine (PRKCA)VKDSTNRDS
HCCCCCHHH
44.39HPRD
Link
373Phosphothreonine (PRKCB)VKDSTNRDS
HCCCCCHHH
44.39HPRD
Link
373Phosphothreonine (PRKCG)VKDSTNRDS
HCCCCCHHH
44.39HPRD
Link
464Phosphoserine (PRKCA)HVTQSSRKL
HCCCCCCCC
23.81HPRD
Link-
464Phosphoserine (PRKCB)HVTQSSRKL
HCCCCCCCC
23.81HPRD
Link-
464Phosphoserine (PRKCG)HVTQSSRKL
HCCCCCCCC
23.81HPRD
Link-
465Phosphoserine (PRKCA)VTQSSRKLI
CCCCCCCCC
24.50HPRD
Link-
465Phosphoserine (PRKCB)VTQSSRKLI
CCCCCCCCC
24.50HPRD
Link-
465Phosphoserine (PRKCG)VTQSSRKLI
CCCCCCCCC
24.50HPRD
Link-
475PhosphoserineADSVSELPA
CCCCCCCCC
37.05HPRD
Link-
475PhosphoserineADSVSELPA
CCCCCCCCC
37.05Phosphositeplus
Link-
558Phosphoserine (PRKCA)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
558Phosphoserine (PRKCB)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
558Phosphoserine (PRKCD)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
558Phosphoserine (PRKCE)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
558Phosphoserine (PRKCG)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
558Phosphoserine (PRKCZ)YESASIRRF
HHHHHHHHH
26.38HPRD
Link
574Phosphothreonine (CAMK2A)IRSATPEAL
CCCCHHHHH
23.94HPRD
Link
574Phosphothreonine (CAMK2G)IRSATPEAL
CCCCHHHHH
23.94HPRD
Link
594Phosphoserine (PRKCA)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
594Phosphoserine (PRKCB)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
594Phosphoserine (PRKCD)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
594Phosphoserine (PRKCE)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
594Phosphoserine (PRKCG)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
594Phosphoserine (PRKCZ)AVPASEKLL
CCCHHHHHH
29.24HPRD
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
GDF2_HUMANENSP00000337103STRING
CHKA_HUMANENSP00000337103STRING
RB_HUMANENSP00000337103STRING
PHOP1_HUMANENSP00000337103STRING
BDNF_HUMANENSP00000337103STRING
ZFP91_HUMANENSP00000337103STRING
PRI1_HUMANENSP00000337103STRING
- top -

Disease Reference
Kegg disease
OMIM disease
254210Myasthenic syndrome, congenital, 6, presynaptic (CMS6)
Drug Reference
DrugBank
DB00122Choline
DB00184Nicotine
- top -
Related Literatures of Post-Translational Modification
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures