Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Cleft lip and palate transmembrane protein 1 homolog  

UniProtKB / Swiss-Prot ID :  CLPT1_MOUSE

Gene Name (Synonyms) : 
Clptm1, N14  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Membrane; Multi-pass membrane protein (Potential). 

Protein Function :  May play a role in T-cell development. 

Transmembrane Topology (topPTM) : CLPT1_MOUSE 

Protein Sequence MAAAQEADGAGSAVVAAGGGSSGQVTSNGSIGRDTPAETQPQNPPPQPAPNAWQVIKGVLFRIFIIWAIS...
Predicted Secondary Structure CCCCCHHCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHH...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
606PhosphoserineGEDVSAAAS
CCCCCCCCC
25.22PhosphoELM
Link-
606PhosphoserineGEDVSAAAS
CCCCCCCCC
25.22Phosphositeplus
Link-
606PhosphoserineGEDVSAAAS
CCCCCCCCC
25.22SysPTM
Link-
606Phosphoserine.GEDVSAAAS
CCCCCCCCC
25.22UniProtKB
Link-
645S-nitrosocysteineTSGACTASQ
CCCCCCCCC
3.59dbSNO
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Protein phosphorylation and expression profiling by Yin-yangmultidimensional liquid chromatography (Yin-yang MDLC) massspectrometry.";
Dai J., Jin W.-H., Sheng Q.-H., Shieh C.-H., Wu J.-R., Zeng R.;
J. Proteome Res. 6:250-262(2007).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-606, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures