Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Chymase  

UniProtKB / Swiss-Prot ID :  CMA1_HUMAN

Gene Name (Synonyms) : 
CMA1, CYH, CYM  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Secreted. Cytoplasmic granule. Note=Mast cell granules. 

Protein Function :  Major secreted protease of mast cells with suspected roles in vasoactive peptide generation, extracellular matrix degradation, and regulation of gland secretion. 

Protein Sequence MLLLPLPLLLFLLCSRAEAGEIIGGTECKPHSRPYMAYLEIVTSNGPSKFCGGFLIRRNFVLTAAHCAGR...
Predicted Secondary Structure CHHHHHHHHHHHHCCCCCCCCEECCEECCCCCCCCEEEEEEEECCCCEEEEEEEEECCCEEEEEEEEECC...
Protein Variant
LocationDescription
46G -> R (in dbSNP:rs5246). VAR_011770
66H -> R (in dbSNP:rs5247). VAR_011771
98R -> H (in dbSNP:rs13306252). VAR_029190
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
35PhosphotyrosineHSRPYMAYL
CCCCCEEEE
8.02Phosphositeplus
Link
38PhosphotyrosinePYMAYLEIV
CCEEEEEEE
6.58Phosphositeplus
Link
80N-linked (GlcNAc...).LGAHNITEE
EEEEEEEEC
42.20UniProtKB
Link
103N-linked (GlcNAc...).HPKYNTSTL
CCCCCCCCC
33.41UniProtKB
Link
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ANGT_HUMANin vitroHPRD:00346HPRD10899625
AACT_HUMANin vitroHPRD:00346HPRD8226889
MMP1_HUMANin vitro
in vivo
HPRD:00346HPRD8027075
EDN3_HUMANin vitroHPRD:00346HPRD9257865
PROF1_HUMANin vitroHPRD:00346HPRD11751973
SCF_HUMANin vitroHPRD:00346HPRD10224464
EDN1_HUMANin vitroHPRD:00346HPRD9257865
EDN2_HUMANin vitroHPRD:00346HPRD9675146
- top -

Disease Reference
Kegg disease
There are no disease associations of PTM sites.
Drug Reference
There are no disease associations of PTM sites.
- top -
Related Literatures of Post-Translational Modification
N-linked Glycosylation
ReferencePubMed
"Structure, chromosomal assignment, and deduced amino acid sequence ofa human gene for mast cell chymase.";
Caughey G.H., Zerweck E.H., Vanderslice P.;
J. Biol. Chem. 266:12956-12963(1991).
Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA].
"Glycoproteomics analysis of human liver tissue by combination ofmultiple enzyme digestion and hydrazide chemistry.";
Chen R., Jiang X., Sun D., Han G., Wang F., Ye M., Wang L., Zou H.;
J. Proteome Res. 8:651-661(2009).
Cited for: GLYCOSYLATION [LARGE SCALE ANALYSIS] AT ASN-80 AND ASN-103, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures