Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Calcium-binding mitochondrial carrier protein Aralar2  

UniProtKB / Swiss-Prot ID :  CMC2_HUMAN

Gene Name (Synonyms) : 
SLC25A13, ARALAR2  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Mitochondrion inner membrane; Multi-pass membrane protein. 

Protein Function :  Catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. May have a function in the urea cycle. 

Transmembrane Topology (topPTM) : CMC2_HUMAN 

Protein Sequence MAAAKVALTKRADPAELRTIFLKYASIEKNGEFFMSPNDFVTRYLNIFGESQPNPKTVELLSGVVDQTKD...
Predicted Secondary Structure CCHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCHHHHHHHHHHHCCCCC...
Protein Variant
LocationDescription
141E -> K (in dbSNP:rs1131697). VAR_050126
232L -> I (in dbSNP:rs10255762). VAR_050127
601E -> K (in NICCD). VAR_016601
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
353Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)IDLVKTRMQ
HHHHHHHHH
37.40Phosphositeplus
Link-
484Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)FGIYKGAKA
HHHHHHHHH
50.93Phosphositeplus
Link-
484N6-acetyllysineFGIYKGAKA
HHHHHHHHH
50.93HPRD
Link-
484N6-acetyllysineFGIYKGAKA
HHHHHHHHH
50.93Phosphositeplus
Link-
484N6-acetyllysine.FGIYKGAKA
HHHHHHHHH
50.93UniProtKB
Link-
519PhosphoserineDGQVSPGSL
CCCCCHHHH
18.69HPRD
Link-
522PhosphoserineVSPGSLLLA
CCHHHHHHH
21.16HPRD
Link-
539PhosphothreonineASLVTPADV
HHHHCCHHH
20.32HPRD
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
ASSY_HUMANENSP00000265631STRING
- top -

Disease Reference
Kegg disease
H00185 Citrullinemia (CTLN)
OMIM disease
603471Citrullinemia 2 (CTLN2)
605814Cholestasis, neonatal intrahepatic, caused by citrin deficiency (NICCD)
Drug Reference
DrugBank
DB00128L-Aspartic Acid
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lysine acetylation targets protein complexes and co-regulates majorcellular functions.";
Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.,Olsen J.V., Mann M.;
Science 325:834-840(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-484, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures