Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  CCR4-NOT transcription complex subunit 10  

UniProtKB / Swiss-Prot ID :  CNOTA_HUMAN

Gene Name (Synonyms) : 
CNOT10  

Species :  Homo sapiens (Human). 

Subcellular Localization :   

Protein Function :   

Protein Sequence MAADKPADQGAEKHEGTGQSSGITDQEKELSTNAFQAFTSGNYDACLQHLACLQDINKDDYKIILNTAVA...
Predicted Secondary Structure  -
Protein Variant
LocationDescription
348T -> S (in dbSNP:rs11558687). VAR_053982
736P -> S (in dbSNP:rs17849684). VAR_037957
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Protein Variant
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
2N-acetylalanine.---MAADKP
---
25.11UniProtKB
Link-
74Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)AEFFKSNQT
54.54Phosphositeplus
Link-
177N6-acetyllysineAVLEKMISQ
37.06Phosphositeplus
Link-
204Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)GSNHKAESG
59.09Phosphositeplus
Link-
241PhosphoserineREIKSVMNT
32.06Phosphositeplus
Link-
245PhosphothreonineSVMNTAGNS
20.18Phosphositeplus
Link-
249PhosphoserineTAGNSAPSL
40.41Phosphositeplus
Link-
256Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)SLFLKSNFE
35.70Phosphositeplus
Link-
271Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)RKAVKLLNS
52.71Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Acetylation
ReferencePubMed
"Lys-N and trypsin cover complementary parts of the phosphoproteome ina refined SCX-based approach.";
Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J.,Mohammed S.;
Anal. Chem. 81:4493-4501(2009).
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT ALA-2, AND MASS SPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures