Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Ciliary neurotrophic factor receptor subunit alpha  

UniProtKB / Swiss-Prot ID :  CNTFR_HUMAN

Gene Name (Synonyms) : 
CNTFR  

Species :  Homo sapiens (Human). 

Subcellular Localization :  Cell membrane; Lipid-anchor, GPI-anchor. 

Protein Function :  Binds to CNTF. The alpha subunit provides the receptor specificity. 

Protein Sequence MAAPVPWACCAVLAAAAAVVYAQRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLN...
Predicted Secondary Structure CCCCCCEEEEEEEEEEEEEEEECCCCCCCCCCCEEEECCCCEEEEECCCCCCCEEEEEECCCCCCHHCCC...
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
Predicted PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
There are no experimentally verified PTM sites.
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
APBP2_HUMANphysical interactionEBI-753619
intact16189514
PLS1_HUMANphysical interactionEBI-759679
intact16189514
KR412_HUMANphysical interactionEBI-760135
intact16189514
APBP2_HUMANyeast 2-hybridHPRD:00348HPRD16189514
PLS1_HUMANyeast 2-hybridHPRD:00348HPRD16189514
KR412_HUMANyeast 2-hybridHPRD:00348HPRD16189514
CRLF1_HUMANENSP00000242338STRING
IL6_HUMANENSP00000242338STRING
LIFR_HUMANENSP00000242338STRING
IL11_HUMANENSP00000242338STRING
STAT3_HUMANENSP00000242338STRING
CLCF1_HUMANENSP00000242338STRING
IL6RB_HUMANENSP00000242338STRING
ZFP91_HUMANENSP00000242338STRING
- top -

Disease Reference
Drug Reference
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures