Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures
Basic Information
Protein Name :  Centlein  

UniProtKB / Swiss-Prot ID :  CNTLN_MOUSE

Gene Name (Synonyms) : 
Cntln  

Species :  Mus musculus (Mouse). 

Subcellular Localization :  Cytoplasm, cytoskeleton, centrosome, centriole. Note=Colocalizes with gamma-tubulin during interphase and mitosis. Appears to associated with the mother centriole during G1 phase and with daughter centrioles towards G1/S phase (By similarity). 

Protein Function :   

Protein Sequence MAARSPSSSPPPPPVRRSSRRSLRVGRGAEVHAVRSEASGLAGAAREVVADKSDLLWRGEEGSGGRRGSG...
Predicted Secondary Structure  -
Protein Variant -
- top -

Overview of Protein Modification Sites with Functional and Structural Information
Accessible Surface Area (ASA)
Pred. Secondary
Real Secondary
Disorder Prediction
Protein Domain
&
Experimental PTM Sites
- top -

Experimental Post-Translational Modification Sites Download
Locations
Modification
Substrate Sites
&
Secondary Structure
Accessible Surface Area (%)
Resource
Reference
Structural Characterization
Orthologous
Protein Cluster
5PhosphoserineMAARSPSSS
25.14Phosphositeplus
Link-
5Phosphoserine.MAARSPSSS
25.14UniProtKB
Link-
9PhosphoserineSPSSSPPPP
45.85Phosphositeplus
Link-
9Phosphoserine.SPSSSPPPP
45.85UniProtKB
Link-
1219PhosphoserineDLKMSVLIS
16.51Phosphositeplus
Link-
1334PhosphothreonineEILDTEDEL
41.72Phosphositeplus
Link-
- top -

Protein-Protein Interactions
      Interacting Protein      
Interaction type
Source ID
      Resource      
      Pubmed ID      
Domain-Domain Interactions
There are no Protein-Protein Interactions.
- top -

Disease Reference
Drug Reference
- top -
Related Literatures of Post-Translational Modification
Phosphorylation
ReferencePubMed
"Large scale localization of protein phosphorylation by use ofelectron capture dissociation mass spectrometry.";
Sweet S.M., Bailey C.M., Cunningham D.L., Heath J.K., Cooper H.J.;
Mol. Cell. Proteomics 8:904-912(2009).
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-5 AND SER-9, AND MASSSPECTROMETRY.
- top -
Basic Information | Overview of PTM Sites | Experimental PTM Sites | Protein-Protein Interactions | Drug and Disease Associations | Related Literatures